Psyllid ID: psy13346

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MSTKQRASVPNQGKHQVCPKPSSRSYDGVPVMKPTDVSTEKTSRKRKHSDKTTRTPDDSPVTECHDSSPVKIRREHASTFVASEDIAVKRKLDILKRSTLRPIVIYYEPKDAKLPSQYKWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIRHCSCSNQHAVLQYRELSLNNTRVVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEGDVIEFGLSTREYVLLHQNSECLQRNVT
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEcccccccEEEEccccEEEEccccccccEEEcccccccccEEEEEEEccccccccEEEEEEEccccccEEEccEEcccccEEEcccccEEEEcccccEEEEEcccccHHccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccEEEEEEEcccccccccccccEEEEEEcccccccEEEEEccEEEEEcccccEEEcccccccccccEEEEEEEEEEcccccEEEEEEEEcccccccEEcccEcccccEEEEccccEEEEcccccEEEEEcccccccccccc
mstkqrasvpnqgkhqvcpkpssrsydgvpvmkptdvstektsrkrkhsdkttrtpddspvtechdsspvkirreHASTFVASEDIAVKRKLDIlkrstlrpiviyyepkdaklpsqykwrlypfknhqplpimyiHRQSAYIIGRNAKVSDILIrhcscsnqHAVLQYRELSLNNTRVVRPYLMDlksmngtfvngmkiaplTYVELFEGDVIEFGLSTREYVLLHQNseclqrnvt
mstkqrasvpnqgkhqvcpkpssrsydgvpvmkptdvstektsrkrkhsdkttrtpddspvtechdsspvkirrehastfvasediavkrkldilkrstlrpiviyyepkdaklpsqYKWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIRHCSCSNQHAVLQYRELSLNNTRVVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEGDVIEFGLSTREYVLlhqnseclqrnvt
MSTKQRASVPNQGKHQVCPKPSSRSYDGVPVMKPTDVSTEKTSRKRKHSDKTTRTPDDSPVTECHDSSPVKIRREHASTFVASEDIAVKRKLDILKRSTLRPIVIYYEPKDAKLPSQYKWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIRHCSCSNQHAVLQYRELSLNNTRVVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEGDVIEFGLSTREYVLLHQNSECLQRNVT
******************************************************************************TFVASEDIAVKRKLDILKRSTLRPIVIYYEPKDAKLPSQYKWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIRHCSCSNQHAVLQYRELSLNNTRVVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEGDVIEFGLSTREYVLLHQN*********
********************************************************************************************************IYYEPKDAKLPSQYKWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIRHCSCSNQHAVLQYRELSLNNTRVVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEGDVIEFGLSTREYVL*************
***************************GVPVMK***********************************PVKIRREHASTFVASEDIAVKRKLDILKRSTLRPIVIYYEPKDAKLPSQYKWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIRHCSCSNQHAVLQYRELSLNNTRVVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEGDVIEFGLSTREYVLLHQNSECLQRNVT
************************************************************************************************RSTLRPIVIYYEPKDAKLPSQYKWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIRHCSCSNQHAVLQYRELSLNNTRVVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEGDVIEFGLSTREYVLLHQ**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTKQRASVPNQGKHQVCPKPSSRSYDGVPVMKPTDVSTEKTSRKRKHSDKTTRTPDDSPVTECHDSSPVKIRREHASTFVASEDIAVKRKLDILKRSTLRPIVIYYEPKDAKLPSQYKWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIRHCSCSNQHAVLQYRELSLNNTRVVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEGDVIEFGLSTREYVLLHQNSECLQRNVT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query238 2.2.26 [Sep-21-2011]
Q8TAD8396 Smad nuclear-interacting yes N/A 0.571 0.343 0.524 1e-38
Q5M9G6389 Smad nuclear interacting yes N/A 0.563 0.344 0.531 1e-38
Q8BIZ6383 Smad nuclear-interacting yes N/A 0.563 0.349 0.531 1e-38
Q8W4D8314 FHA domain-containing pro yes N/A 0.533 0.404 0.485 4e-31
Q54VU41505 Probable serine/threonine yes N/A 0.504 0.079 0.472 5e-27
Q9BWU0 796 Kanadaptin OS=Homo sapien no N/A 0.483 0.144 0.341 7e-08
Q12972 351 Nuclear inhibitor of prot no N/A 0.361 0.245 0.336 8e-08
Q28147 351 Nuclear inhibitor of prot no N/A 0.361 0.245 0.336 8e-08
Q8R3G1 351 Nuclear inhibitor of prot no N/A 0.361 0.245 0.336 9e-08
Q9Y4F5 1589 Centrosomal protein of 17 no N/A 0.285 0.042 0.378 3e-06
>sp|Q8TAD8|SNIP1_HUMAN Smad nuclear-interacting protein 1 OS=Homo sapiens GN=SNIP1 PE=1 SV=1 Back     alignment and function desciption
 Score =  159 bits (403), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 103/143 (72%), Gaps = 7/143 (4%)

Query: 98  STLRPIVIYY-EPKDAKLPSQYKWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIR 156
           +T R +VI Y EP +A++P + +WRLYPFKN + LP+MYIHRQSAY++GR+ +++DI I 
Sbjct: 237 NTFRGVVIKYSEPPEARIPKK-RWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPID 295

Query: 157 HCSCSNQHAVLQYRELSLNNT-----RVVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEG 211
           H SCS QHAV QYR +          R V+PY++DL S NGTF+N  +I P  Y EL E 
Sbjct: 296 HPSCSKQHAVFQYRLVEYTRADGTVGRRVKPYIIDLGSGNGTFLNNKRIEPQRYYELKEK 355

Query: 212 DVIEFGLSTREYVLLHQNSECLQ 234
           DV++FG S+REYVLLH++S+  +
Sbjct: 356 DVLKFGFSSREYVLLHESSDTSE 378
Down-regulates NF-kappa-B signaling by competing with RELA for CREBBP/EP300 binding. Involved in the microRNA (miRNA) biogenesis.
Homo sapiens (taxid: 9606)
>sp|Q5M9G6|SNIP1_RAT Smad nuclear interacting protein 1 OS=Rattus norvegicus GN=Snip1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BIZ6|SNIP1_MOUSE Smad nuclear-interacting protein 1 OS=Mus musculus GN=Snip1 PE=1 SV=1 Back     alignment and function description
>sp|Q8W4D8|DDL_ARATH FHA domain-containing protein DDL OS=Arabidopsis thaliana GN=DDL PE=1 SV=1 Back     alignment and function description
>sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 Back     alignment and function description
>sp|Q9BWU0|NADAP_HUMAN Kanadaptin OS=Homo sapiens GN=SLC4A1AP PE=1 SV=1 Back     alignment and function description
>sp|Q12972|PP1R8_HUMAN Nuclear inhibitor of protein phosphatase 1 OS=Homo sapiens GN=PPP1R8 PE=1 SV=2 Back     alignment and function description
>sp|Q28147|PP1R8_BOVIN Nuclear inhibitor of protein phosphatase 1 OS=Bos taurus GN=PPP1R8 PE=1 SV=1 Back     alignment and function description
>sp|Q8R3G1|PP1R8_MOUSE Nuclear inhibitor of protein phosphatase 1 OS=Mus musculus GN=Ppp1r8 PE=1 SV=1 Back     alignment and function description
>sp|Q9Y4F5|C170B_HUMAN Centrosomal protein of 170 kDa protein B OS=Homo sapiens GN=CEP170B PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query238
432910394 360 PREDICTED: smad nuclear-interacting prot 0.563 0.372 0.539 5e-38
380011390 351 PREDICTED: uncharacterized protein LOC10 0.558 0.378 0.564 7e-38
148222109 373 Smad nuclear interacting protein 1 [Xeno 0.563 0.359 0.539 9e-38
322792329303 hypothetical protein SINV_06301 [Solenop 0.554 0.435 0.561 1e-37
345780557 397 PREDICTED: smad nuclear-interacting prot 0.571 0.342 0.531 1e-37
383856695 359 PREDICTED: uncharacterized protein LOC10 0.533 0.353 0.548 1e-37
410966798 400 PREDICTED: smad nuclear-interacting prot 0.571 0.34 0.531 2e-37
48094349 351 PREDICTED: hypothetical protein LOC41067 0.558 0.378 0.557 2e-37
291408776 397 PREDICTED: Smad nuclear interacting prot 0.563 0.337 0.539 2e-37
301777027 397 PREDICTED: smad nuclear-interacting prot 0.571 0.342 0.531 2e-37
>gi|432910394|ref|XP_004078345.1| PREDICTED: smad nuclear-interacting protein 1-like isoform 1 [Oryzias latipes] Back     alignment and taxonomy information
 Score =  163 bits (413), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 76/141 (53%), Positives = 101/141 (71%), Gaps = 7/141 (4%)

Query: 98  STLRPIVIYY-EPKDAKLPSQYKWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIR 156
           +T R +VI Y EP +A++P + +WRLYPFKN +PLP+MY+HRQSAY++GR  K++DI I 
Sbjct: 199 NTFRGVVIKYNEPPEARIPKR-RWRLYPFKNDEPLPVMYVHRQSAYLLGRQRKIADIPID 257

Query: 157 HCSCSNQHAVLQYRELSLNNT-----RVVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEG 211
           H SCS QHAV QYR +          R VRPY++DL S NGT++N  +I P  Y EL E 
Sbjct: 258 HPSCSKQHAVFQYRLVQYTRADGTTGRRVRPYIIDLASGNGTYLNNQRIEPQRYYELKEK 317

Query: 212 DVIEFGLSTREYVLLHQNSEC 232
           DV++FG S+REYVLLH+ S+ 
Sbjct: 318 DVLKFGFSSREYVLLHEFSDT 338

Source: Oryzias latipes

Species: Oryzias latipes

Genus: Oryzias

Family: Adrianichthyidae

Order: Beloniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota
>gi|380011390|ref|XP_003689790.1| PREDICTED: uncharacterized protein LOC100863987 [Apis florea] Back     alignment and taxonomy information
>gi|148222109|ref|NP_001086846.1| Smad nuclear interacting protein 1 [Xenopus laevis] gi|50415442|gb|AAH77541.1| MGC83354 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|322792329|gb|EFZ16313.1| hypothetical protein SINV_06301 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|345780557|ref|XP_532557.3| PREDICTED: smad nuclear-interacting protein 1 [Canis lupus familiaris] Back     alignment and taxonomy information
>gi|383856695|ref|XP_003703843.1| PREDICTED: uncharacterized protein LOC100877772 [Megachile rotundata] Back     alignment and taxonomy information
>gi|410966798|ref|XP_003989916.1| PREDICTED: smad nuclear-interacting protein 1 [Felis catus] Back     alignment and taxonomy information
>gi|48094349|ref|XP_394149.1| PREDICTED: hypothetical protein LOC410672 [Apis mellifera] Back     alignment and taxonomy information
>gi|291408776|ref|XP_002720708.1| PREDICTED: Smad nuclear interacting protein-like [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|301777027|ref|XP_002923931.1| PREDICTED: smad nuclear-interacting protein 1-like [Ailuropoda melanoleuca] gi|281349705|gb|EFB25289.1| hypothetical protein PANDA_013157 [Ailuropoda melanoleuca] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query238
UNIPROTKB|E2R797397 SNIP1 "Uncharacterized protein 0.558 0.335 0.542 8.3e-39
UNIPROTKB|Q8TAD8396 SNIP1 "Smad nuclear-interactin 0.558 0.335 0.535 1.7e-38
UNIPROTKB|F1P3G6373 SNIP1 "Uncharacterized protein 0.579 0.369 0.531 1.5e-35
UNIPROTKB|E1BNB3399 SNIP1 "Uncharacterized protein 0.558 0.333 0.535 1.5e-35
UNIPROTKB|I3LQU1261 SNIP1 "Uncharacterized protein 0.558 0.509 0.535 1.5e-35
MGI|MGI:2156003383 Snip1 "Smad nuclear interactin 0.558 0.347 0.535 1.5e-35
RGD|1359268389 Snip1 "Smad nuclear interactin 0.558 0.341 0.535 1.5e-35
FB|FBgn0039943421 CG17168 [Drosophila melanogast 0.537 0.304 0.514 3.9e-35
WB|WBGene00016323299 C32E8.5 [Caenorhabditis elegan 0.546 0.434 0.510 1.8e-32
TAIR|locus:2085740314 DDL "AT3G20550" [Arabidopsis t 0.882 0.668 0.369 3.3e-31
UNIPROTKB|E2R797 SNIP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 387 (141.3 bits), Expect = 8.3e-39, Sum P(2) = 8.3e-39
 Identities = 76/140 (54%), Positives = 102/140 (72%)

Query:    98 STLRPIVIYY-EPKDAKLPSQYKWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIR 156
             +T R +VI Y EP +A++P + +WRLYPFKN + LP+MYIHRQSAY++GR+ +++DI I 
Sbjct:   238 NTFRGVVIKYSEPPEARIPKK-RWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPID 296

Query:   157 HCSCSNQHAVLQYRELSLNNT-----RVVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEG 211
             H SCS QHAV QYR +          R VRPY++DL S NGTF+N  +I P  Y EL E 
Sbjct:   297 HPSCSKQHAVFQYRLVEYTRADGTVGRRVRPYIIDLGSGNGTFLNNKRIEPQRYYELKEK 356

Query:   212 DVIEFGLSTREYVLLHQNSE 231
             DV++FG S+REYVLLH++S+
Sbjct:   357 DVLKFGFSSREYVLLHESSD 376
GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=IEA
GO:0007249 "I-kappaB kinase/NF-kappaB cascade" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
UNIPROTKB|Q8TAD8 SNIP1 "Smad nuclear-interacting protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3G6 SNIP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNB3 SNIP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LQU1 SNIP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2156003 Snip1 "Smad nuclear interacting protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1359268 Snip1 "Smad nuclear interacting protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0039943 CG17168 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00016323 C32E8.5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TAIR|locus:2085740 DDL "AT3G20550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8TAD8SNIP1_HUMANNo assigned EC number0.52440.57140.3434yesN/A
Q5M9G6SNIP1_RATNo assigned EC number0.53190.56300.3444yesN/A
Q8BIZ6SNIP1_MOUSENo assigned EC number0.53190.56300.3498yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
cd00060102 cd00060, FHA, Forkhead associated domain (FHA); fo 1e-23
pfam0049867 pfam00498, FHA, FHA domain 8e-16
smart0024052 smart00240, FHA, Forkhead associated domain 2e-11
COG1716191 COG1716, COG1716, FOG: FHA domain [Signal transduc 3e-07
>gnl|CDD|238017 cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins Back     alignment and domain information 
 Score = 90.9 bits (226), Expect = 1e-23
 Identities = 34/99 (34%), Positives = 47/99 (47%), Gaps = 7/99 (7%)

Query: 119 KWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIRHCSCSNQHAVLQYRELSLNNTR 178
             RL            Y+     Y IGR++   DI++   S S +HAV++Y         
Sbjct: 1   VPRLVVLSGDASGRRYYLDPGGTYTIGRDSDNCDIVLDDPSVSRRHAVIRYDG------- 53

Query: 179 VVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEGDVIEFG 217
                L+DL S NGTFVNG +++P   V L +GDVI  G
Sbjct: 54  DGGVVLIDLGSTNGTFVNGQRVSPGEPVRLRDGDVIRLG 92

Putative nuclear signalling domain. FHA domains may bind phosphothreonine, phosphoserine and sometimes phosphotyrosine. In eukaryotes, many FHA domain-containing proteins localize to the nucleus, where they participate in establishing or maintaining cell cycle checkpoints, DNA repair, or transcriptional regulation. Members of the FHA family include: Dun1, Rad53, Cds1, Mek1, KAPP(kinase-associated protein phosphatase),and Ki-67 (a human nuclear protein related to cell proliferation). Length = 102
>gnl|CDD|215951 pfam00498, FHA, FHA domain Back     alignment and domain information
>gnl|CDD|214578 smart00240, FHA, Forkhead associated domain Back     alignment and domain information
>gnl|CDD|224630 COG1716, COG1716, FOG: FHA domain [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 238
KOG1882|consensus293 99.96
PF0049868 FHA: FHA domain; InterPro: IPR000253 The forkhead- 99.81
KOG1881|consensus 793 99.75
cd00060102 FHA Forkhead associated domain (FHA); found in euk 99.68
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 99.58
KOG1880|consensus 337 99.56
TIGR03354 396 VI_FHA type VI secretion system FHA domain protein 99.56
COG1716191 FOG: FHA domain [Signal transduction mechanisms] 99.49
smart0024052 FHA Forkhead associated domain. Found in eukaryoti 99.37
COG3456 430 Predicted component of the type VI protein secreti 99.14
KOG0615|consensus 475 98.41
TIGR02500 410 type_III_yscD type III secretion apparatus protein 98.21
KOG2293|consensus547 97.5
KOG0245|consensus 1221 97.22
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 96.78
KOG1892|consensus 1629 96.42
KOG0241|consensus 1714 93.19
PRK15367 395 type III secretion system protein SsaD; Provisiona 88.27
>KOG1882|consensus Back     alignment and domain information 
Probab=99.96  E-value=6e-31  Score=226.94  Aligned_cols=140  Identities=51%  Similarity=0.870  Sum_probs=129.1

Q ss_pred             hhhhhcCCCC-ccccCCCCCCCCCCCCceEEEEeeCCCCCceEEeecCCeEEEeeeCCcccEEeCCCcccccceEEEEEe
Q psy13346         93 DILKRSTLRP-IVIYYEPKDAKLPSQYKWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIRHCSCSNQHAVLQYRE  171 (238)
Q Consensus        93 ~~~e~n~~~G-~~~~~~P~~a~~P~~~~w~L~v~kg~~~~~~~~l~~~~~~~IGR~~~~~DI~l~d~sVSr~Ha~I~~~~  171 (238)
                      +..+.|.+.| +++|++|++|+.|.. .|+|+.+++...+..+.++.+++|++||....+||.|++|+||++||+|+|..
T Consensus       147 l~E~tn~~~gv~v~y~eppearkP~k-RwrLy~fk~~e~l~~l~iHrqs~yL~gRerkIaDi~idhpScSKQHaviQyR~  225 (293)
T KOG1882|consen  147 LLEDTNRFRGVVVKYNEPPEARKPKK-RWRLYPFKCYEVLPVLYIHRQSCYLDGRERKIADIPIDHPSCSKQHAVIQYRL  225 (293)
T ss_pred             hhhhhcceeeEEEEecCCchhcCchh-heecccccCCcccchheeeeeeeeecCceeeeeccCCCCccccccceeeeeee
Confidence            3459999999 999999999999999 99999999999999999999999999999888999999999999999999987


Q ss_pred             eccCC-----cccceEEEEeCCCCCceeECCEEcCCCceEEccCCCEEEEcCeeEEEEEecCCCchh
Q psy13346        172 LSLNN-----TRVVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEGDVIEFGLSTREYVLLHQNSECL  233 (238)
Q Consensus       172 ~~~~~-----~~~~~~~I~DlgS~NGT~VNg~rI~~~~~~~L~~GD~I~~G~~~~~fvl~~~~~~~~  233 (238)
                      ..-+.     |...++||+||||.||||||+.+|++..|++|..+|+|+||.+..+|||+++.+...
T Consensus       226 v~~~r~dGt~grrvkpYiiDLgS~NgTfLNnk~IepqRYyEL~ekDvlkfgfs~rEyvllhe~s~~~  292 (293)
T KOG1882|consen  226 VEFTRADGTVGRRVKPYIIDLGSGNGTFLNNKVIEPQRYYELREKDVLKFGFSSREYVLLHEISMNV  292 (293)
T ss_pred             cccccCCCccceeeeeEEEecCCCCcceecCcccCchheeeeecCceeeeccchHHHHHHHhhhccc
Confidence            65322     556689999999999999999999999999999999999999999999999886654

>PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins Back     alignment and domain information
>KOG1881|consensus Back     alignment and domain information
>cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>KOG1880|consensus Back     alignment and domain information
>TIGR03354 VI_FHA type VI secretion system FHA domain protein Back     alignment and domain information
>COG1716 FOG: FHA domain [Signal transduction mechanisms] Back     alignment and domain information
>smart00240 FHA Forkhead associated domain Back     alignment and domain information
>COG3456 Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>TIGR02500 type_III_yscD type III secretion apparatus protein, YscD/HrpQ family Back     alignment and domain information
>KOG2293|consensus Back     alignment and domain information
>KOG0245|consensus Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>PRK15367 type III secretion system protein SsaD; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
3vpy_A145 Crystal Structure Of Arabidopsis Ddl Fha Domain Len 1e-29
4h87_A130 Crystal Structure Of A Fha Domain Of Kanadaptin (Sl 8e-09
2jpe_A140 Fha Domain Of Nipp1 Length = 140 8e-09
3elv_A205 Crystal Structure Of Full-Length Yeast Pml1p Length 6e-07
3els_A158 Crystal Structure Of Yeast Pml1p, Residues 51-204 L 1e-06
2jkd_A187 Structure Of The Yeast Pml1 Splicing Factor And Its 1e-06
>pdb|3VPY|A Chain A, Crystal Structure Of Arabidopsis Ddl Fha Domain Length = 145 Back     alignment and structure 
Iteration: 1

 Score =  126 bits (317), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 90/137 (65%), Gaps = 7/137 (5%)
Query: 104 VIYYEPKDAKLPSQYKWRLYPFKNHQPL-PIMYIHRQSAYIIGRNAKVSDILIRHCSCSN 162
           +++ EP +A+ PS+ +WRLY FK+ +PL   + +HRQS Y+ GR  +++DI   H SCS 
Sbjct: 2   LLFNEPPEARKPSE-RWRLYVFKDGEPLNEPLCLHRQSCYLFGRERRIADIPTDHPSCSK 60
Query: 163 QHAVLQYRELSLNN-----TRVVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEGDVIEFG 217
           QHAV+QYRE           + V+PY+ DL S N T++N   I P  Y ELFE D I+FG
Sbjct: 61  QHAVIQYREXEKEKPDGXXGKQVKPYIXDLGSTNKTYINESPIEPQRYYELFEKDTIKFG 120
Query: 218 LSTREYVLLHQNSECLQ 234
            S+REYVLLH+NS  L+
Sbjct: 121 NSSREYVLLHENSAELE 137
>pdb|4H87|A Chain A, Crystal Structure Of A Fha Domain Of Kanadaptin (Slc4a1ap) From Homo Sapiens At 1.55 A Resolution Length = 130 Back     alignment and structure
>pdb|2JPE|A Chain A, Fha Domain Of Nipp1 Length = 140 Back     alignment and structure
>pdb|3ELV|A Chain A, Crystal Structure Of Full-Length Yeast Pml1p Length = 205 Back     alignment and structure
>pdb|3ELS|A Chain A, Crystal Structure Of Yeast Pml1p, Residues 51-204 Length = 158 Back     alignment and structure
>pdb|2JKD|A Chain A, Structure Of The Yeast Pml1 Splicing Factor And Its Integration Into The Res Complex Length = 187 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
2jpe_A140 Nuclear inhibitor of protein phosphatase 1; FHA do 3e-43
3els_A158 PRE-mRNA leakage protein 1; intrinsically unstruct 1e-34
3elv_A205 PRE-mRNA leakage protein 1; intrinsically unstruct 9e-30
1uht_A118 Expressed protein; FHA domain, beta-sandwich, anti 7e-18
3va4_A132 Mediator of DNA damage checkpoint protein 1; cell 2e-16
3gqs_A106 Adenylate cyclase-like protein; FHA domain, struct 8e-15
2csw_A145 Ubiquitin ligase protein RNF8; 11-stranded beta sa 1e-14
2jqj_A151 DNA damage response protein kinase DUN1; protein/p 3e-14
2pie_A138 E3 ubiquitin-protein ligase RNF8; FHA domain, comp 7e-14
1mzk_A139 Kinase associated protein phosphatase; beta sandwi 8e-14
1g6g_A127 Protein kinase RAD53; beta-sandwich, phosphopeptid 2e-13
1gxc_A149 CHK2, CDS1, serine/threonine-protein kinase CHK2; 5e-13
1lgp_A116 Cell cycle checkpoint protein CHFR; FHA, tungstate 5e-13
1g3g_A164 Protien kinase SPK1; FHA domain, RAD53, phosphopep 9e-13
3hx1_A131 SLR1951 protein; P74513_SYNY3, adenylate cyclase-l 1e-12
2xt9_B115 Putative signal transduction protein GARA; lyase-s 5e-11
1r21_A128 Antigen KI-67; beta sandwich, cell cycle; NMR {Hom 6e-11
3po8_A100 RV0020C protein, putative uncharacterized protein 7e-11
2kb3_A143 Oxoglutarate dehydrogenase inhibitor; forkhead-ass 3e-10
3oun_A157 Putative uncharacterized protein TB39.8; peptidogl 4e-10
2kfu_A162 RV1827 PThr 22; FHA domain, phosphorylation, intra 6e-10
3huf_A 325 DNA repair and telomere maintenance protein NBS1; 9e-10
1dmz_A158 Protein (protein kinase SPK1); beta-sandwich, anti 1e-09
1qu5_A182 Protein kinase SPK1; FHA, RAD53, transferase; NMR 5e-09
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 9e-08
1wln_A120 Afadin; beta sandwich, FHA domain, structural geno 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
1ujx_A119 Polynucleotide kinase 3'-phosphatase; DNA repair, 2e-04
>2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} Length = 140 Back     alignment and structure
 Score =  141 bits (358), Expect = 3e-43
 Identities = 36/130 (27%), Positives = 58/130 (44%), Gaps = 7/130 (5%)

Query: 98  STLRPIVIYYEPKDAKLPSQYKWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIRH 157
           ++   + ++  P  A  P      L   K  + +  + I  +  Y+ GRN  + D  I H
Sbjct: 14  NSGSSLPLFDCPTWAGKPPP-GLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDFTIDH 72

Query: 158 CSCSNQHAVLQYRELSLNNTRVVRPYLMDLKSMNGTFVNGMKIAPLTYVELFEGDVIEFG 217
            SCS  HA L Y +         R +L+DL S +GTF+  +++ P    ++     + FG
Sbjct: 73  QSCSRVHAALVYHKHL------KRVFLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFG 126

Query: 218 LSTREYVLLH 227
            STR Y L  
Sbjct: 127 ASTRAYTLRE 136
>3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} Length = 158 Back     alignment and structure
>3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A Length = 205 Back     alignment and structure
>1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 Length = 118 Back     alignment and structure
>3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Length = 132 Back     alignment and structure
>3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Length = 106 Back     alignment and structure
>2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 Length = 145 Back     alignment and structure
>2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Length = 151 Back     alignment and structure
>2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 Length = 138 Back     alignment and structure
>1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 127 Back     alignment and structure
>1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 Length = 149 Back     alignment and structure
>1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Length = 116 Back     alignment and structure
>1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Length = 164 Back     alignment and structure
>3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Length = 131 Back     alignment and structure
>2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} Length = 115 Back     alignment and structure
>1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Length = 128 Back     alignment and structure
>3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} PDB: 3poa_A* 2lc1_A Length = 100 Back     alignment and structure
>2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A Length = 143 Back     alignment and structure
>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 Back     alignment and structure
>2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A Length = 162 Back     alignment and structure
>3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* Length = 325 Back     alignment and structure
>1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* Length = 158 Back     alignment and structure
>1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 182 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Length = 120 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ujx_A Polynucleotide kinase 3'-phosphatase; DNA repair, FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif; NMR {Mus musculus} SCOP: b.26.1.2 Length = 119 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query238
4h87_A130 Kanadaptin; FHA domain of PF00498, mRNA processing 99.98
3elv_A205 PRE-mRNA leakage protein 1; intrinsically unstruct 99.96
3els_A158 PRE-mRNA leakage protein 1; intrinsically unstruct 99.95
2jpe_A140 Nuclear inhibitor of protein phosphatase 1; FHA do 99.94
3gqs_A106 Adenylate cyclase-like protein; FHA domain, struct 99.91
1uht_A118 Expressed protein; FHA domain, beta-sandwich, anti 99.9
2xt9_B115 Putative signal transduction protein GARA; lyase-s 99.88
3va4_A132 Mediator of DNA damage checkpoint protein 1; cell 99.88
2kb3_A143 Oxoglutarate dehydrogenase inhibitor; forkhead-ass 99.87
1mzk_A139 Kinase associated protein phosphatase; beta sandwi 99.87
2kfu_A162 RV1827 PThr 22; FHA domain, phosphorylation, intra 99.87
2jqj_A151 DNA damage response protein kinase DUN1; protein/p 99.86
1r21_A128 Antigen KI-67; beta sandwich, cell cycle; NMR {Hom 99.86
3po8_A100 RV0020C protein, putative uncharacterized protein 99.85
1g3g_A164 Protien kinase SPK1; FHA domain, RAD53, phosphopep 99.84
3hx1_A131 SLR1951 protein; P74513_SYNY3, adenylate cyclase-l 99.84
2pie_A138 E3 ubiquitin-protein ligase RNF8; FHA domain, comp 99.84
1gxc_A149 CHK2, CDS1, serine/threonine-protein kinase CHK2; 99.84
1lgp_A116 Cell cycle checkpoint protein CHFR; FHA, tungstate 99.83
2csw_A145 Ubiquitin ligase protein RNF8; 11-stranded beta sa 99.83
1dmz_A158 Protein (protein kinase SPK1); beta-sandwich, anti 99.83
3oun_A157 Putative uncharacterized protein TB39.8; peptidogl 99.82
1g6g_A127 Protein kinase RAD53; beta-sandwich, phosphopeptid 99.79
1qu5_A182 Protein kinase SPK1; FHA, RAD53, transferase; NMR 99.79
1wln_A120 Afadin; beta sandwich, FHA domain, structural geno 99.77
4ejq_A154 Kinesin-like protein KIF1A; homodimer, FHA domain, 99.74
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 99.74
3huf_A 325 DNA repair and telomere maintenance protein NBS1; 99.73
3fm8_A124 Kinesin-like protein KIF13B; kinesin, GAP, GTPase 99.68
4a0e_A123 YSCD, type III secretion protein; transport protei 99.58
3uv0_A102 Mutator 2, isoform B; FHA, protein binding, dimeri 99.51
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.44
3kt9_A102 Aprataxin; FHA domain, beta sandwich, beta sheet, 99.41
4egx_A184 Kinesin-like protein KIF1A; FHA domain, transport 99.25
2brf_A110 Bifunctional polynucleotide phosphatase/kinase; hy 99.25
1yj5_C143 5' polynucleotide kinase-3' phosphatase FHA domai; 99.23
1ujx_A119 Polynucleotide kinase 3'-phosphatase; DNA repair, 99.11
1wv3_A238 Similar to DNA segregation ATPase and related prot 98.99
1wv3_A 238 Similar to DNA segregation ATPase and related prot 83.27
>4h87_A Kanadaptin; FHA domain of PF00498, mRNA processing, nucleus, structural joint center for structural genomics, JCSG, protein structu initiative; HET: SO4; 1.55A {Homo sapiens} Back     alignment and structure
Probab=99.98  E-value=7.8e-32  Score=215.42  Aligned_cols=123  Identities=33%  Similarity=0.418  Sum_probs=107.7

Q ss_pred             ccccCCCCCCCCCCCCceEEEEeeCCCCCceEEeecCCeEEEeeeCCcccEEeCCCcccccceEEEEEeeccC---Cccc
Q psy13346        103 IVIYYEPKDAKLPSQYKWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIRHCSCSNQHAVLQYRELSLN---NTRV  179 (238)
Q Consensus       103 ~~~~~~P~~a~~P~~~~w~L~v~kg~~~~~~~~l~~~~~~~IGR~~~~~DI~l~d~sVSr~Ha~I~~~~~~~~---~~~~  179 (238)
                      ...|.+|+||..|.. .|+|++++++..+..+.|..+..|+|||++ .|||+|++++|||+||+|+++.....   ....
T Consensus         5 ~ppy~~P~wa~~p~~-~~~L~v~k~g~~~~~~~L~~~~~~~IGR~~-~~di~l~~~~VSr~HA~I~~r~~~~~~~~~~~~   82 (130)
T 4h87_A            5 APPYQEPPWGGPATA-PYSLETLKGGTILGTRSLKGTSYCLFGRLS-GCDVCLEHPSVSRYHAVLQHRASGPDGECDSNG   82 (130)
T ss_dssp             CCSCCCCTTBCCCCS-CCEEEEEETTEEEEEEECTTCSEEEEESST-TSSEECCCTTSCSSCEEEEEBCCCCCC------
T ss_pred             CcCCCCCCCccCCCC-CEEEEEEECCeeeeeEEeCCCceEEEcCCc-CCCEEeCCCCcchhcEEEEEecccCccceeccC
Confidence            345899999999998 999999999999999999988989999995 69999999999999999988532110   0124


Q ss_pred             ceEEEEeCCCCCceeECCEEcCCCceEEccCCCEEEEcCeeEEEEEec
Q psy13346        180 VRPYLMDLKSMNGTFVNGMKIAPLTYVELFEGDVIEFGLSTREYVLLH  227 (238)
Q Consensus       180 ~~~~I~DlgS~NGT~VNg~rI~~~~~~~L~~GD~I~~G~~~~~fvl~~  227 (238)
                      ..|+|+||+|+|||||||++|.++++++|++||+|+||.+++.|+|++
T Consensus        83 ~~~~l~Dl~StNGT~vNg~ri~~~~~~~L~~GD~I~~G~str~yvl~G  130 (130)
T 4h87_A           83 PGFYLYDLGSTHGTFLNKTRIPPRTYCRVHVGHVVRFGGSTRLFILQG  130 (130)
T ss_dssp             CCEEEEECSCSSCEEETTEECCTTCCEECCTTCEEEETTCSEEEEEEC
T ss_pred             CcceEeeCCCCCceEECCEECCCCceeECCCCCEEEECCceEEEEEcC
Confidence            579999999999999999999999999999999999999999999974
>3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A Back     alignment and structure
>3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} Back     alignment and structure
>3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Back     alignment and structure
>1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 Back     alignment and structure
>2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} Back     alignment and structure
>3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Back     alignment and structure
>2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A Back     alignment and structure
>2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A Back     alignment and structure
>2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Back     alignment and structure
>1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Back     alignment and structure
>3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} SCOP: b.26.1.0 PDB: 3poa_A* 2lc1_A Back     alignment and structure
>1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Back     alignment and structure
>3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Back     alignment and structure
>2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Back     alignment and structure
>2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* Back     alignment and structure
>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Back     alignment and structure
>1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Back     alignment and structure
>1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 Back     alignment and structure
>1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* Back     alignment and structure
>3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* Back     alignment and structure
>4a0e_A YSCD, type III secretion protein; transport protein, SAD phasing, type III secretion system; 2.04A {Yersinia pestis} PDB: 4d9v_A Back     alignment and structure
>3uv0_A Mutator 2, isoform B; FHA, protein binding, dimerization; 1.90A {Drosophila melanogaster} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3kt9_A Aprataxin; FHA domain, beta sandwich, beta sheet, AMP hydrolase, alternative splicing, disease mutation, DNA damage, DNA repair, DNA-binding; 1.65A {Homo sapiens} SCOP: b.26.1.0 Back     alignment and structure
>4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} Back     alignment and structure
>2brf_A Bifunctional polynucleotide phosphatase/kinase; hydrolase/transferase, FHA, forkhead-associated, PNKP, PNK, polynucleotide kinase 3' phosphatase; 1.40A {Homo sapiens} SCOP: b.26.1.2 PDB: 2w3o_A* 1yjm_A* Back     alignment and structure
>1yj5_C 5' polynucleotide kinase-3' phosphatase FHA domai; beta sandwich, P-loop, transferase; 2.80A {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>1ujx_A Polynucleotide kinase 3'-phosphatase; DNA repair, FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif; NMR {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>1wv3_A Similar to DNA segregation ATPase and related proteins; structural genomics, unknown function; 1.75A {Staphylococcus aureus subsp} SCOP: b.26.1.4 b.26.1.4 Back     alignment and structure
>1wv3_A Similar to DNA segregation ATPase and related proteins; structural genomics, unknown function; 1.75A {Staphylococcus aureus subsp} SCOP: b.26.1.4 b.26.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 238
d1uhta_118 b.26.1.2 (A:) FHA domain containing protein At4G14 6e-18
d1mzka_122 b.26.1.2 (A:) Kinase associated protein phosphatas 1e-14
d1dmza_158 b.26.1.2 (A:) Phosphotyrosine binding domain of Ra 3e-14
d1g6ga_127 b.26.1.2 (A:) Phosphotyrosine binding domain of Ra 5e-10
d1gxca_116 b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [T 6e-10
d2ff4a399 b.26.1.2 (A:284-382) Probable regulatory protein E 7e-09
d2g1la1102 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {H 1e-08
d1lgpa_113 b.26.1.2 (A:) Cell cycle checkpoint protein Chfr { 1e-08
d2piea1127 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 2e-07
d2affa198 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapi 6e-07
d2brfa1101 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosph 1e-05
>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 118 Back     information, alignment and structure

class: All beta proteins
fold: SMAD/FHA domain
superfamily: SMAD/FHA domain
family: FHA domain
domain: FHA domain containing protein At4G14490
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 74.7 bits (183), Expect = 6e-18
 Identities = 28/109 (25%), Positives = 43/109 (39%), Gaps = 8/109 (7%)

Query: 120 WRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIRHCSCSNQHAVLQYRELSLNNTRV 179
            RL   K  +    +     S   +GR  + ++I I+    S +H  ++           
Sbjct: 13  LRLVFVKGPREGDALDYKPGSTIRVGRIVRGNEIAIKDAGISTKHLRIESDS-------- 64

Query: 180 VRPYLMDLKSMNGTFVNGMKIAPLTYVELFEGDVIEFGLSTREYVLLHQ 228
               + DL S NGT +N   + P T V L +GDVI+ G  T   V    
Sbjct: 65  GNWVIQDLGSSNGTLLNSNALDPETSVNLGDGDVIKLGEYTSILVNFVS 113
>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 122 Back     information, alignment and structure
>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 158 Back     information, alignment and structure
>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 127 Back     information, alignment and structure
>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 99 Back     information, alignment and structure
>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query238
d1uhta_118 FHA domain containing protein At4G14490 {Thale cre 99.92
d1mzka_122 Kinase associated protein phosphatase {Thale cress 99.87
d2ff4a399 Probable regulatory protein EmbR, C-terminal domai 99.87
d2piea1127 Ubiquitin ligase protein RNF8 {Human (Homo sapiens 99.83
d2affa198 Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1gxca_116 Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1lgpa_113 Cell cycle checkpoint protein Chfr {Human (Homo sa 99.78
d1g6ga_127 Phosphotyrosine binding domain of Rad53 {Baker's y 99.78
d2brfa1101 Polynucleotide kinase 3'-phosphatase {Human (Homo 99.77
d1dmza_158 Phosphotyrosine binding domain of Rad53 {Baker's y 99.77
d2g1la1102 Kinesin-like protein kif1c {Human (Homo sapiens) [ 99.73
d1wlna1107 Afadin {Mouse (Mus musculus) [TaxId: 10090]} 99.68
>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All beta proteins
fold: SMAD/FHA domain
superfamily: SMAD/FHA domain
family: FHA domain
domain: FHA domain containing protein At4G14490
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.92  E-value=6.7e-25  Score=170.49  Aligned_cols=103  Identities=27%  Similarity=0.289  Sum_probs=93.4

Q ss_pred             ceEEEEeeCCCCCceEEeecCCeEEEeeeCCcccEEeCCCcccccceEEEEEeeccCCcccceEEEEeCCCCCceeECCE
Q psy13346        119 KWRLYPFKNHQPLPIMYIHRQSAYIIGRNAKVSDILIRHCSCSNQHAVLQYRELSLNNTRVVRPYLMDLKSMNGTFVNGM  198 (238)
Q Consensus       119 ~w~L~v~kg~~~~~~~~l~~~~~~~IGR~~~~~DI~l~d~sVSr~Ha~I~~~~~~~~~~~~~~~~I~DlgS~NGT~VNg~  198 (238)
                      .++|.+.+|...+..+.|..+..++|||....|||.|+|+.|||+||+|.++        ++.|+|+||+|+|||||||+
T Consensus        12 ~l~L~v~~Gp~~g~~~~l~~~~~~~iGR~~~~~di~l~d~~VSr~Ha~i~~~--------~~~~~i~Dl~S~nGT~vng~   83 (118)
T d1uhta_          12 SLRLVFVKGPREGDALDYKPGSTIRVGRIVRGNEIAIKDAGISTKHLRIESD--------SGNWVIQDLGSSNGTLLNSN   83 (118)
T ss_dssp             EEEEEESSSTTTTCBCCBCTTCCEEEESSSTTCSEECCSSSSCTTCEEEEEC--------SSSEEEECCCCSSCCEESSS
T ss_pred             cEEEEEEeCCCCCcEEEeCCCCEEEECCCCcCCeEEeCccCcchheeEEEEE--------CCEEEEEECCCcceeEECCE
Confidence            6789999999999999998788899999855799999999999999999997        46899999999999999999


Q ss_pred             EcCCCceEEccCCCEEEEcCeeEEEEEecCC
Q psy13346        199 KIAPLTYVELFEGDVIEFGLSTREYVLLHQN  229 (238)
Q Consensus       199 rI~~~~~~~L~~GD~I~~G~~~~~fvl~~~~  229 (238)
                      +|.++.++.|.+||+|+||..++.|+...+.
T Consensus        84 ~l~~~~~~~L~~Gd~i~lG~~~~~~v~~~~~  114 (118)
T d1uhta_          84 ALDPETSVNLGDGDVIKLGEYTSILVNFVSG  114 (118)
T ss_dssp             BCCTTCEEECCTTEEEEETTTEEEEEEEECS
T ss_pred             EcCCCcEEECCCCCEEEECCEEEEEEEecCC
Confidence            9999889999999999999999888765543
>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure