Diaphorina citri psyllid: psy13347

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34

AQGQQVQQLQQDPNDPTRFQILNLCSPGGGGVTTSIEMVNQEEDSLEEKPRSRRVACTCPNCTEGGEREMFSYMLHGCLWGNTMEYALAARVLKLKIYKTTAEVNNKIRLSSYFYPALISTLFSCSLRTADRKKVHICHIEGCNKVYGKTSHLRAHLRWHTGERPFVCTWQFCGKRFTRSDELQVNGGRFGIERTVVRILPMTWCREKRFQCSECHKKFMRSDHLQKHIKTHSKTRCTSLVMNFSDNTVVTEDSKLELSGGSTGAGTPESWINTDGNRCFLVNIEAPGTNGGAESPGLRPLSPDDGGSSSSGDEKMMITLGGETGEGSELTIVTDGTDC

ccccccccccccccccccCECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccCEEccccccccEEccHHHHHHHHcccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccEEEEccccccccEEEEccccccc

*******************QILNLCS****************************VACTCPNCTEGGEREMFSYMLHGCLWGNTMEYALAARVLKLKIYKTTAEVNNKIRLSSYFYPALISTLFSCSLRTADRKKVHICHIEGCNKVYGKTSHLRAHLRWHTGERPFVCTWQFCGKRFTRSDELQVNGGRFGIERTVVRILPMTWCREKRFQCSECHKKFMRSDHLQKHIKTHSKTRCTSLVMNFSDNTVV*******************SWINTDGNRCFLVNIE****************************************EGSELTIVTDGT**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription factor Sp3	Transcriptional factor that can act as an activator or repressor depending on post-translational modifications. Binds to GT and GC boxes promoter elements. Competes with SP1 for the GC-box promoters. Weak activator of transcription (By similarity). Required for activation of SPARC transcription.	confident	Q90WR8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0003674 [MF]	molecular_function	probable
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 66-70,94-188,203-257
View the alignment between query and template
View the model in PyMOL