Diaphorina citri psyllid: psy13362


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MLEREKAKMTAQMFEFNDICWDKCMTDKPGQRLDSKTETCIVNCVDSFPVFHHFNKPSQIERLNFDDGSISTSGLKANSNKDLEDFLMLEREKAKMTAQTGSTCFISPRVITLGLRFGFGYKILRIHAFARISTSGLKANSNKDLEDFLMLEREKAKMTAQMFEFNDICWDKCMTDKPGQRLDSKTETCIVNCVDRFIDISMFIANRLTQRTNGLD
cHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccccccHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccEEEEHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
**********AQMFEFNDICWDKCMTDKPGQRLDSKTETCIVNCVDSFPVFHHFNKPSQIERL**********************FLM**R******AQTGSTCFISPRVITLGLRFGFGYKILRIHAFARISTSGLKAN**KDLEDFLMLEREKAKMTAQMFEFNDICWDKCMTDKPGQRLDSKTETCIVNCVDRFIDISMFIANRL********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEREKAKMTAQMFEFNDICWDKCMTDKPGQRLDSKTETCIVNCVDSFPVFHHFNKPSQIERLNFDDGSISTSGLKANSNKDLEDFLMLEREKAKMTAQTGSTCFISPRVITLGLRFGFGYKILRIHAFARISTSGLKANSNKDLEDFLMLEREKAKMTAQMFEFNDICWDKCMTDKPGQRLDSKTETCIVNCVDRFIDISMFIANRLTQRTNGLD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial import inner membrane translocase subunit Tim8 Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The Tim8-Tim13 complex mediates the import of some proteins while the predominant Tim9-Tim10 70 kDa complex mediates the import of much more proteins.confidentQ9Y1A3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005758 [CC]mitochondrial intermembrane spaceprobableGO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CJH, chain B
Confidence level:very confident
Coverage over the Query: 153-211
View the alignment between query and template
View the model in PyMOL
Template: 3CJH, chain B
Confidence level:very confident
Coverage over the Query: 4-61
View the alignment between query and template
View the model in PyMOL