Diaphorina citri psyllid: psy13364

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----

MPPVGMTTTIKQKSPILAGNFAVWGAMFSTIDCSLVYVRKKEDPWNSIISGAATGGILAARNGVPAMAGSALIGGKVRTLELVLLFEPAPNQGTSIISFYNFLTYRYRWIYLRGHRPLTYGYNKSKELRSSPVMERYVNYGENLVHVEATPEVELEEYAREPCPWRIVDDCGGAFTMGLIGGALFHGIKGFRNAPSGMNRRFLGMTTTIKQKSPILAGNFAVWGAMFSTIDCSLVYVRKKEDPWNSIISGAATGGILAARNGVPAMAGSALIGGKLKRLDFNCLK

cccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccc

*******TTIKQKSPILAGNFAVWGAMFSTIDCSLVYVRKKEDPWNSIISGAATGGILAARNGVPAMAGSALIGGKVRTLELVLLFEPAPNQGTSIISFYNFLTYRYRWIYLRGHRPLTYGYNKSKELRSSPVMERYVNYGENLVHVEATPEVELEEYAREPCPWRIVDDCGGAFTMGLIGGALFHGIKGFRNAPSGMNRRFLGMTTTIKQKSPILAGNFAVWGAMFSTIDCSLVYVRKKEDPWNSIISGAATGGILAARNGVPAMAGSALIGGKLKRLDFNCLK

xxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mitochondrial import inner membrane translocase subunit tim17	Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.	confident	P87130
Mitochondrial import inner membrane translocase subunit TIM17-2	Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.	confident	Q9SP35
Mitochondrial import inner membrane translocase subunit TIM17	Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.	confident	P39515

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0003674 [MF]	molecular_function	probable
GO:0005741 [CC]	mitochondrial outer membrane	probable	GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0006626 [BP]	protein targeting to mitochondrion	probable	GO:0008104, GO:0051649, GO:0071840, GO:0044699, GO:0070727, GO:0006886, GO:0016043, GO:0007005, GO:0071702, GO:0016482, GO:0006810, GO:0072594, GO:0034613, GO:0006605, GO:0045184, GO:0033365, GO:0044765, GO:0044763, GO:0072655, GO:0006839, GO:0051234, GO:0051179, GO:0051641, GO:0006996, GO:0070585, GO:0033036, GO:0046907, GO:0015031, GO:0008150, GO:0009987
GO:0015630 [CC]	microtubule cytoskeleton	probable	GO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005744 [CC]	mitochondrial inner membrane presequence translocase complex	probable	GO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0044429, GO:0044424, GO:0044425, GO:0044422
GO:0031305 [CC]	integral to mitochondrial inner membrane	probable	GO:0044464, GO:0031975, GO:0031304, GO:0043229, GO:0031301, GO:0031300, GO:0032592, GO:0043227, GO:0043226, GO:0031224, GO:0005737, GO:0005575, GO:0031090, GO:0016021, GO:0016020, GO:0044444, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043231, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0005740, GO:0044429, GO:0044424, GO:0044425, GO:0044422

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted