Psyllid ID: psy13369


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MVILREREMKRSQDPPTQEGKLRVYSMRFCPYAQRVHLILLAKKIPLTIHVPVTQYRLIGSIFPTWLTTESETHWNRTCSSYFEQKKRREREMKRSQDPPTQEGKLRVYSMRFCPYAQRLSPAFYKCMMGEGINPSTFGEIVTALEPLEAELKARGTPYLSGSKPGMVDYMIWPWLERLPSLAELAGPEYALPADKFAQLVSSQDPPTQEGKIRVYSMRFCPYAQRVHLILLAKKIPHDPVFINLNEKPEWYVSSVPTGKVPALKSEGSILYESLIISDYLDEKYEGNRKLIASSPLQRALDRIFLETFGK
cccccHHHcccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEEcccccccccccccEEEEcccEEEEHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHcccccccccccccEEcccccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHcccccccEEEEccEEEcHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcc
cccccHHHcccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEEEHHHcccccccEEEEEccccEEEEEHEHHHHHHHHcccccccccccccccccccEEEEEccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHcHHHccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEEEccccccHHHHHccccccccEEEEccccEEEcHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcc
MVILREremkrsqdpptqegklrvysmrfcpYAQRVHLILLAkkipltihvpvtqyrligsifptwlttesethwnrtCSSYFEQKKRREREmkrsqdpptqegklrvysmrfcpyaqrlspafykcmmgeginpstfGEIVTALEPLEAELkargtpylsgskpgmvdymiwpwlerlpslaelagpeyalpadkFAQLvssqdpptqegkirvysmrfcPYAQRVHLILLAkkiphdpvfinlnekpewyvssvptgkvpalksegsILYESLIISDYldekyegnRKLIASSPLQRALDRIFLETFGK
mvilreremkrsqdpptqegklrvYSMRFCPYAQRVHLILLAKKIPLTIHVPVTQYRLIGSIFPTWlttesethwnrtcssyfeqkkrreremkrsqdpptqegklrvysMRFCPYAQRLSPAFYKCMMGEGINPSTFGEIVTALEPLEAELKArgtpylsgskpGMVDYMIWPWLERLPSLAELAGPEYALPADKFAQLVSSQDPPTQEGKIRVYSMRFCPYAQRVHLILLAKKIPHDPVFINLNEKPEWYVSSVPTGKVPALKSEGSILYESLIISDYLDEKYEGNRKliassplqralDRIFLETFGK
MVILREREMKRSQDPPTQEGKLRVYSMRFCPYAQRVHLILLAKKIPLTIHVPVTQYRLIGSIFPTWLTTESETHWNRTCSSYFeqkkrreremkrSQDPPTQEGKLRVYSMRFCPYAQRLSPAFYKCMMGEGINPSTFGEIVTALEPLEAELKARGTPYLSGSKPGMVDYMIWPWLERLPSLAELAGPEYALPADKFAQLVSSQDPPTQEGKIRVYSMRFCPYAQRVHLILLAKKIPHDPVFINLNEKPEWYVSSVPTGKVPALKSEGSILYESLIISDYLDEKYEGNRKLIASSPLQRALDRIFLETFGK
*********************LRVYSMRFCPYAQRVHLILLAKKIPLTIHVPVTQYRLIGSIFPTWLTTESETHWNRTCSSYF**********************LRVYSMRFCPYAQRLSPAFYKCMMGEGINPSTFGEIVTALEPLEAELKARGTPYLSGSKPGMVDYMIWPWLERLPSLAELAGPEYALPADKFAQ************KIRVYSMRFCPYAQRVHLILLAKKIPHDPVFINLNEKPEWYVSSVPTGKVPALKSEGSILYESLIISDYLDEKYEGNRKLIASSPLQRALDRIFLE****
*********************LRVYSMRFCPYAQRVHLILLAKKIPLTIHVPVTQYRLIGSIFPTWLTTESETHWNRTCSSYFEQKKRREREMKRSQDPPTQEGKLRVYSMRFCPYAQRLSPAFYKCMM******STFGEIVTALEPLEAELKARGTPYLSGSKPGMVDYMIWPWLERLPSLAELAGPEYALPADKFAQLVSSQDPPTQEGKIRVYSMRFCPYAQRVHLILLAKKIPHDPVFINLNEKPEWYVSSVPTGKVPALKSEGSILYESLIISDYLDEKYEGNRKLIASSPLQRALDRIFLETFGK
*******************GKLRVYSMRFCPYAQRVHLILLAKKIPLTIHVPVTQYRLIGSIFPTWLTTESETHWNRTCSSYFE******************EGKLRVYSMRFCPYAQRLSPAFYKCMMGEGINPSTFGEIVTALEPLEAELKARGTPYLSGSKPGMVDYMIWPWLERLPSLAELAGPEYALPADKFAQLV********EGKIRVYSMRFCPYAQRVHLILLAKKIPHDPVFINLNEKPEWYVSSVPTGKVPALKSEGSILYESLIISDYLDEKYEGNRKLIASSPLQRALDRIFLETFGK
************QDPPTQEGKLRVYSMRFCPYAQRVHLILLAKKIPLTIHVPVTQYRLIGSIFPTWLTTESETHWNRTCSSYFEQKKRREREMKRSQDPPTQEGKLRVYSMRFCPYAQRLSPAFYKCMMGEGINPSTFGEIVTALEPLEAELKARGTPYLSGSKPGMVDYMIWPWLERLPSLAELAGPEYALPADKFAQLVSSQDPPTQEGKIRVYSMRFCPYAQRVHLILLAKKIPHDPVFINLNEKPEWYVSSVPTGKVPALKSEGSILYESLIISDYLDEKYEGNRKLIASSPLQRALDRIFLETFGK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVILREREMKRSQDPPTQEGKLRVYSMRFCPYAQRVHLILLAKKIPLTIHVPVTQYRLIGSIFPTWLTTESETHWNRTCSSYFEQKKRREREMKRSQDPPTQEGKLRVYSMRFCPYAQRLSPAFYKCMMGEGINPSTFGEIVTALEPLEAELKARGTPYLSGSKPGMVDYMIWPWLERLPSLAELAGPEYALPADKFAQLVSSQDPPTQEGKIRVYSMRFCPYAQRVHLILLAKKIPHDPVFINLNEKPEWYVSSVPTGKVPALKSEGSILYESLIISDYLDEKYEGNRKLIASSPLQRALDRIFLETFGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query311 2.2.26 [Sep-21-2011]
P78417 241 Glutathione S-transferase yes N/A 0.334 0.431 0.490 2e-22
Q9H4Y5 243 Glutathione S-transferase no N/A 0.350 0.448 0.5 6e-22
Q9N1F5 241 Glutathione S-transferase no N/A 0.334 0.431 0.490 4e-21
Q8K2Q2 248 Glutathione S-transferase yes N/A 0.334 0.419 0.481 5e-21
Q6AXV9 248 Glutathione S-transferase yes N/A 0.334 0.419 0.481 6e-21
O09131 240 Glutathione S-transferase no N/A 0.334 0.433 0.481 9e-21
Q9Z339 241 Glutathione S-transferase no N/A 0.334 0.431 0.462 6e-20
P34345 250 Glutathione transferase o no N/A 0.327 0.408 0.349 1e-13
P34277 254 Probable glutathione tran no N/A 0.347 0.425 0.368 9e-13
A8XT16 253 Probable glutathione tran N/A N/A 0.337 0.415 0.379 1e-11
>sp|P78417|GSTO1_HUMAN Glutathione S-transferase omega-1 OS=Homo sapiens GN=GSTO1 PE=1 SV=2 Back     alignment and function desciption
 Score =  106 bits (265), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 70/106 (66%), Gaps = 2/106 (1%)

Query: 207 PTQEGKIRVYSMRFCPYAQRVHLILLAKKIPHDPVFINLNEKPEWYVSSVPTGKVPALK- 265
           P  EG IR+YSMRFCP+A+R  L+L AK I H+ + INL  KPEW+    P G VP L+ 
Sbjct: 18  PVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLEN 77

Query: 266 SEGSILYESLIISDYLDEKYEGNRKLIASSPLQRALDRIFLETFGK 311
           S+G ++YES I  +YLDE Y G +KL+   P ++A  ++ LE F K
Sbjct: 78  SQGQLIYESAITCEYLDEAYPG-KKLLPDDPYEKACQKMILELFSK 122




Exhibits glutathione-dependent thiol transferase and dehydroascorbate reductase activities. Has S-(phenacyl)glutathione reductase activity. Has also glutathione S-transferase activity. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA) and dimethylarsonic acid.
Homo sapiens (taxid: 9606)
EC: 1EC: .EC: 2EC: 0EC: .EC: 4EC: .EC: 2
>sp|Q9H4Y5|GSTO2_HUMAN Glutathione S-transferase omega-2 OS=Homo sapiens GN=GSTO2 PE=1 SV=1 Back     alignment and function description
>sp|Q9N1F5|GSTO1_PIG Glutathione S-transferase omega-1 OS=Sus scrofa GN=GSTO1 PE=1 SV=2 Back     alignment and function description
>sp|Q8K2Q2|GSTO2_MOUSE Glutathione S-transferase omega-2 OS=Mus musculus GN=Gsto2 PE=2 SV=1 Back     alignment and function description
>sp|Q6AXV9|GSTO2_RAT Glutathione S-transferase omega-2 OS=Rattus norvegicus GN=Gsto2 PE=2 SV=1 Back     alignment and function description
>sp|O09131|GSTO1_MOUSE Glutathione S-transferase omega-1 OS=Mus musculus GN=Gsto1 PE=2 SV=2 Back     alignment and function description
>sp|Q9Z339|GSTO1_RAT Glutathione S-transferase omega-1 OS=Rattus norvegicus GN=Gsto1 PE=1 SV=2 Back     alignment and function description
>sp|P34345|GSTO1_CAEEL Glutathione transferase omega-1 OS=Caenorhabditis elegans GN=gsto-1 PE=1 SV=1 Back     alignment and function description
>sp|P34277|GSTO2_CAEEL Probable glutathione transferase omega-2 OS=Caenorhabditis elegans GN=gsto-2 PE=3 SV=5 Back     alignment and function description
>sp|A8XT16|GSTO2_CAEBR Probable glutathione transferase omega-2 OS=Caenorhabditis briggsae GN=gsto-2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
270003033 474 hypothetical protein TcasGA2_TC000055 [T 0.871 0.571 0.343 2e-36
387413362239 glutathione s-transferase O1 [Nilaparvat 0.353 0.460 0.675 9e-36
373940167204 glutathione S-transferase o1 [Laodelphax 0.353 0.539 0.675 2e-35
387413586239 glutathione s-transferase O1 [Sogatella 0.353 0.460 0.648 4e-34
429326689239 glutathione S-transferase [Coptotermes f 0.350 0.456 0.603 4e-28
289177000241 glutathione S-transferase O1 [Nasonia vi 0.350 0.452 0.549 3e-27
58387722248 AGAP005749-PA [Anopheles gambiae str. PE 0.356 0.447 0.547 3e-27
170027632257 glutathione S-transferase [Culex quinque 0.360 0.435 0.533 5e-27
268308996248 glutathione S-transferase omega class 1 0.360 0.451 0.542 5e-27
240848631239 glutathione S-transferase omega-1-like [ 0.350 0.456 0.563 1e-26
>gi|270003033|gb|EEZ99480.1| hypothetical protein TcasGA2_TC000055 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 113/329 (34%), Positives = 153/329 (46%), Gaps = 58/329 (17%)

Query: 12  SQDPPTQEGKLRVYSMRFCPYAQRVHLILLAKKIPLTI------HVPVTQYRLIGSIFPT 65
           S  PP  EGKLR+YSM +CPYA RV L+L AK IP  I      + P   +++    +  
Sbjct: 10  SPQPPKIEGKLRLYSMEYCPYAHRVRLVLNAKNIPHDIVNINLINQPEWYFKIHPQGYVP 69

Query: 66  WLTTESETHWNRTCSSYFEQKKRREREMKRSQDPPTQEGKLRVYSMRFCPYAQRLSPAFY 125
            L T S+          F  +K     +   QDP +++    +         Q +   F 
Sbjct: 70  ALDTGSQIVIESLHICDFLDEKYPSPPL-FPQDPASKQRDKDLLKK-----IQPMHGVFL 123

Query: 126 KCM-MGEGINPSTFG-EIVTALEPLEAELKARGTPYLSGSKPGMVDYMIWPWLERLPSLA 183
           +C+ + E  +   +  E V  LE  E EL  RGT +  G KPGMVDYM+WPW ER+ ++ 
Sbjct: 124 RCISLNENKSLEEWATEFVPHLETFETELSNRGTTFFGGEKPGMVDYMLWPWGERVGTIV 183

Query: 184 ELAGPEYALPADKFAQL------------------------------------------- 200
              G +    +D+F  L                                           
Sbjct: 184 IAHGQQLPFASDQFPLLRKWRKAMRGDPVCDGLYYGPEKYWKIIQIKFRKAPPEYTDCLI 243

Query: 201 -VSSQDPPTQEGKIRVYSMRFCPYAQRVHLILLAKKIPHDPVFINLNEKPEWYVSSVPTG 259
              SQ P   +GK+R+YS  FCPYAQRV L+L AK IPHD V I+L+ KPEWY    P  
Sbjct: 244 DSGSQQPLKVDGKLRLYSAEFCPYAQRVRLVLKAKNIPHDIVNISLSHKPEWYSKIHPEE 303

Query: 260 KVPALKSEGSILYESLIISDYLDEKYEGN 288
           KVPAL +   I+ ESL I ++LDE+Y  N
Sbjct: 304 KVPALDTGTKIIIESLDIVEFLDEQYPKN 332




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|387413362|gb|AFJ75806.1| glutathione s-transferase O1 [Nilaparvata lugens] Back     alignment and taxonomy information
>gi|373940167|gb|AEY80036.1| glutathione S-transferase o1 [Laodelphax striatella] Back     alignment and taxonomy information
>gi|387413586|gb|AFJ75814.1| glutathione s-transferase O1 [Sogatella furcifera] Back     alignment and taxonomy information
>gi|429326689|gb|AFZ78680.1| glutathione S-transferase [Coptotermes formosanus] Back     alignment and taxonomy information
>gi|289177000|ref|NP_001165912.1| glutathione S-transferase O1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|58387722|ref|XP_315763.2| AGAP005749-PA [Anopheles gambiae str. PEST] gi|30088852|gb|AAP13482.1| glutathione transferase o1 [Anopheles gambiae] gi|55238550|gb|EAA11710.2| AGAP005749-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170027632|ref|XP_001841701.1| glutathione S-transferase [Culex quinquefasciatus] gi|167862271|gb|EDS25654.1| glutathione S-transferase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|268308996|gb|ACY95464.1| glutathione S-transferase omega class 1 [Anopheles cracens] Back     alignment and taxonomy information
>gi|240848631|ref|NP_001155757.1| glutathione S-transferase omega-1-like [Acyrthosiphon pisum] gi|239788690|dbj|BAH71013.1| ACYPI008340 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
FB|FBgn0035906 267 GstO2 "Glutathione S transfera 0.418 0.486 0.463 5.7e-27
FB|FBgn0035904 241 GstO3 "Glutathione S transfera 0.315 0.406 0.561 1.6e-24
UNIPROTKB|F1MKB7 241 GSTO1 "Uncharacterized protein 0.334 0.431 0.509 3.3e-24
UNIPROTKB|P78417 241 GSTO1 "Glutathione S-transfera 0.350 0.452 0.477 4.2e-24
UNIPROTKB|E1BX85 239 GSTO1 "Uncharacterized protein 0.350 0.456 0.513 4.2e-24
UNIPROTKB|Q9H4Y5 243 GSTO2 "Glutathione S-transfera 0.347 0.444 0.504 8.7e-24
UNIPROTKB|J3KQ23166 GSTO2 "Glutathione S-transfera 0.347 0.650 0.504 8.7e-24
UNIPROTKB|F1S5N4 244 SSC.25138 "Uncharacterized pro 0.334 0.426 0.509 2.3e-23
UNIPROTKB|E1BJ08 241 GSTO1 "Uncharacterized protein 0.350 0.452 0.477 2.9e-23
UNIPROTKB|E1BKU3142 GSTO1 "Uncharacterized protein 0.350 0.767 0.477 2.9e-23
FB|FBgn0035906 GstO2 "Glutathione S transferase O2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 303 (111.7 bits), Expect = 5.7e-27, P = 5.7e-27
 Identities = 63/136 (46%), Positives = 87/136 (63%)

Query:   176 LERLPSLAELAGPEYALPADKFAQLVSSQDPPTQEGKIRVYSMRFCPYAQRVHLILLAKK 235
             + RL +  ++   + ALP   F +     + P ++G +R YSMRFCPY+QR  L+L AKK
Sbjct:     5 ISRLGNYFKIVN-KMALPQKHFKRGSPKPEIP-EDGVLRYYSMRFCPYSQRAGLVLAAKK 62

Query:   236 IPHDPVFINLNEKPEWYVSSVPTGKVPALKSEG----SILYESLIISDYLDEKYEGNRKL 291
             IPH  V+I+L+EKPEWY+   P GKVPA++         L ESL+I++YLDE+Y G   L
Sbjct:    63 IPHHTVYIDLSEKPEWYIDYSPLGKVPAIQLPNLPGQPALVESLVIAEYLDEQYPGEGSL 122

Query:   292 IASSPLQRALDRIFLE 307
                 PLQ+ALDRI +E
Sbjct:   123 FPKDPLQKALDRILIE 138


GO:0004364 "glutathione transferase activity" evidence=ISS;IDA;NAS
GO:0005737 "cytoplasm" evidence=IEA
GO:0016782 "transferase activity, transferring sulfur-containing groups" evidence=IDA
GO:0045174 "glutathione dehydrogenase (ascorbate) activity" evidence=NAS;IDA
GO:0004734 "pyrimidodiazepine synthase activity" evidence=IDA
GO:0006979 "response to oxidative stress" evidence=IMP
GO:0008340 "determination of adult lifespan" evidence=IMP
GO:0006749 "glutathione metabolic process" evidence=IDA
FB|FBgn0035904 GstO3 "Glutathione S transferase O3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1MKB7 GSTO1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P78417 GSTO1 "Glutathione S-transferase omega-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BX85 GSTO1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H4Y5 GSTO2 "Glutathione S-transferase omega-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KQ23 GSTO2 "Glutathione S-transferase omega-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S5N4 SSC.25138 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BJ08 GSTO1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKU3 GSTO1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.5.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
cd0305589 cd03055, GST_N_Omega, GST_N family, Class Omega su 1e-32
pfam1341775 pfam13417, GST_N_3, Glutathione S-transferase, N-t 2e-19
cd03184124 cd03184, GST_C_Omega, C-terminal, alpha helical do 1e-18
cd0057071 cd00570, GST_N_family, Glutathione S-transferase ( 2e-15
COG0625 211 COG0625, Gst, Glutathione S-transferase [Posttrans 2e-14
pfam1340968 pfam13409, GST_N_2, Glutathione S-transferase, N-t 5e-14
cd0305589 cd03055, GST_N_Omega, GST_N family, Class Omega su 5e-12
PLN02817 265 PLN02817, PLN02817, glutathione dehydrogenase (asc 1e-10
cd0305973 cd03059, GST_N_SspA, GST_N family, Stringent starv 6e-10
cd0305376 cd03053, GST_N_Phi, GST_N family, Class Phi subfam 6e-09
cd0305589 cd03055, GST_N_Omega, GST_N family, Class Omega su 2e-07
PLN02378 213 PLN02378, PLN02378, glutathione S-transferase DHAR 2e-07
TIGR01262 210 TIGR01262, maiA, maleylacetoacetate isomerase 7e-07
cd0306071 cd03060, GST_N_Omega_like, GST_N family, Omega-lik 6e-06
cd0304273 cd03042, GST_N_Zeta, GST_N family, Class Zeta subf 2e-05
cd0305874 cd03058, GST_N_Tau, GST_N family, Class Tau subfam 5e-05
pfam0279874 pfam02798, GST_N, Glutathione S-transferase, N-ter 6e-05
cd0304973 cd03049, GST_N_3, GST_N family, unknown subfamily 1e-04
pfam1341069 pfam13410, GST_C_2, Glutathione S-transferase, C-t 1e-04
cd00299100 cd00299, GST_C_family, C-terminal, alpha helical d 2e-04
cd0305076 cd03050, GST_N_Theta, GST_N family, Class Theta su 4e-04
cd0305673 cd03056, GST_N_4, GST_N family, unknown subfamily 5e-04
cd0304881 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-lik 0.001
PRK10357 202 PRK10357, PRK10357, putative glutathione S-transfe 0.001
PRK15113 214 PRK15113, PRK15113, glutathione S-transferase; Pro 0.002
pfam0004392 pfam00043, GST_C, Glutathione S-transferase, C-ter 0.004
>gnl|CDD|239353 cd03055, GST_N_Omega, GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
 Score =  115 bits (290), Expect = 1e-32
 Identities = 48/81 (59%), Positives = 60/81 (74%), Gaps = 1/81 (1%)

Query: 203 SQDPPTQEGKIRVYSMRFCPYAQRVHLILLAKKIPHDPVFINLNEKPEWYVSSVPTGKVP 262
           S +PP   G IR+YSMRFCPYAQR  L+L AK IPH+ + INL +KP+W++   P GKVP
Sbjct: 9   SAEPPPVPGIIRLYSMRFCPYAQRARLVLAAKNIPHEVININLKDKPDWFLEKNPQGKVP 68

Query: 263 AL-KSEGSILYESLIISDYLD 282
           AL   EG ++YESLII +YLD
Sbjct: 69  ALEIDEGKVVYESLIICEYLD 89


The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. Class Omega GSTs show little or no GSH-conjugating activity towards standard GST substrates. Instead, they catalyze the GSH dependent reduction of protein disulfides, dehydroascorbate and monomethylarsonate, activities which are more characteristic of glutaredoxins. They contain a conserved cysteine equivalent to the first cysteine in the CXXC motif of glutaredoxins, which is a redox active residue capable of reducing GSH mixed disulfides in a monothiol mechanism. Polymorphisms of the class Omega GST genes may be associated with the development of some types of cancer and the age-at-onset of both Alzheimer's and Parkinson's diseases. Length = 89

>gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|198293 cd03184, GST_C_Omega, C-terminal, alpha helical domain of Class Omega Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|239353 cd03055, GST_N_Omega, GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|166458 PLN02817, PLN02817, glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>gnl|CDD|239357 cd03059, GST_N_SspA, GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>gnl|CDD|239351 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>gnl|CDD|239353 cd03055, GST_N_Omega, GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|166019 PLN02378, PLN02378, glutathione S-transferase DHAR1 Back     alignment and domain information
>gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase Back     alignment and domain information
>gnl|CDD|239358 cd03060, GST_N_Omega_like, GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>gnl|CDD|239340 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|239356 cd03058, GST_N_Tau, GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|239347 cd03049, GST_N_3, GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family Back     alignment and domain information
>gnl|CDD|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>gnl|CDD|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>gnl|CDD|239346 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>gnl|CDD|182405 PRK10357, PRK10357, putative glutathione S-transferase; Provisional Back     alignment and domain information
>gnl|CDD|185068 PRK15113, PRK15113, glutathione S-transferase; Provisional Back     alignment and domain information
>gnl|CDD|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 311
KOG0406|consensus231 99.96
KOG0868|consensus217 99.95
PRK09481211 sspA stringent starvation protein A; Provisional 99.94
PLN02473214 glutathione S-transferase 99.92
PRK15113214 glutathione S-transferase; Provisional 99.91
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 99.91
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 99.9
COG0625211 Gst Glutathione S-transferase [Posttranslational m 99.9
PRK11752264 putative S-transferase; Provisional 99.89
PRK10542201 glutathionine S-transferase; Provisional 99.89
PRK10357202 putative glutathione S-transferase; Provisional 99.89
PLN02395215 glutathione S-transferase 99.88
PRK10387210 glutaredoxin 2; Provisional 99.87
PTZ00057205 glutathione s-transferase; Provisional 99.86
PLN02378213 glutathione S-transferase DHAR1 99.85
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 99.84
PRK09481 211 sspA stringent starvation protein A; Provisional 99.84
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 99.83
KOG0867|consensus226 99.82
PLN02817265 glutathione dehydrogenase (ascorbate) 99.82
KOG0868|consensus 217 99.82
PRK15113 214 glutathione S-transferase; Provisional 99.81
KOG0406|consensus 231 99.81
PLN02473 214 glutathione S-transferase 99.76
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 99.75
COG0625 211 Gst Glutathione S-transferase [Posttranslational m 99.74
PRK13972 215 GSH-dependent disulfide bond oxidoreductase; Provi 99.73
PRK10357 202 putative glutathione S-transferase; Provisional 99.73
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 99.72
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 99.72
PLN02395 215 glutathione S-transferase 99.71
TIGR01262 210 maiA maleylacetoacetate isomerase. Maleylacetoacet 99.71
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 99.71
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 99.7
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 99.69
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 99.69
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 99.69
PRK10542201 glutathionine S-transferase; Provisional 99.69
PRK11752 264 putative S-transferase; Provisional 99.68
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 99.68
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 99.67
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 99.67
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 99.67
KOG0867|consensus 226 99.66
PLN02907 722 glutamate-tRNA ligase 99.66
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 99.66
KOG1695|consensus206 99.65
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 99.65
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 99.64
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 99.63
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 99.63
PLN02378 213 glutathione S-transferase DHAR1 99.63
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 99.62
KOG1422|consensus221 99.62
PRK10387 210 glutaredoxin 2; Provisional 99.62
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 99.62
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 99.62
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 99.62
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 99.61
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 99.61
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 99.61
TIGR00862 236 O-ClC intracellular chloride channel protein. Thes 99.6
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 99.6
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 99.59
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 99.58
TIGR02182 209 GRXB Glutaredoxin, GrxB family. This model include 99.58
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 99.57
PLN02817 265 glutathione dehydrogenase (ascorbate) 99.57
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 99.55
KOG4420|consensus325 99.55
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 99.54
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 99.51
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 99.48
PTZ00057205 glutathione s-transferase; Provisional 99.47
KOG1695|consensus 206 99.45
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 99.42
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 99.37
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 99.37
KOG4420|consensus 325 99.36
KOG3029|consensus370 99.34
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 99.31
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 99.31
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 99.31
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 99.29
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 99.29
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; G 99.27
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 99.26
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 99.26
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 99.26
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 99.25
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 99.24
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 99.23
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 99.23
KOG2903|consensus319 99.21
COG2999 215 GrxB Glutaredoxin 2 [Posttranslational modificatio 99.2
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 99.18
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 99.18
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 99.18
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 99.17
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 99.16
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 99.16
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 99.14
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 99.14
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 99.12
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 99.12
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; compose 99.1
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 99.09
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 99.08
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 99.07
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 99.06
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevi 99.06
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 99.05
PLN02907 722 glutamate-tRNA ligase 99.04
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 99.04
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 99.04
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; 99.03
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs 99.01
cd03191121 GST_C_Zeta GST_C family, Class Zeta subfamily; GST 99.01
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 99.0
KOG1422|consensus 221 99.0
PRK1063883 glutaredoxin 3; Provisional 99.0
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed 98.99
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 98.99
cd03186107 GST_C_SspA GST_N family, Stringent starvation prot 98.98
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 98.97
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GST 98.96
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and 98.95
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; compose 98.94
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevi 98.91
KOG4244|consensus281 98.9
COG2999215 GrxB Glutaredoxin 2 [Posttranslational modificatio 98.86
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 98.85
cd03179105 GST_C_1 GST_C family, unknown subfamily 1; compose 98.85
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Ch 98.84
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 98.82
cd03192104 GST_C_Sigma_like GST_C family, Class Sigma_like; c 98.81
PF0004395 GST_C: Glutathione S-transferase, C-terminal domai 98.8
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; compose 98.78
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamil 98.78
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar 98.78
PF1341069 GST_C_2: Glutathione S-transferase, C-terminal dom 98.77
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; 98.76
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 98.76
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductas 98.75
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; compo 98.73
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; G 98.71
PF1449799 GST_C_3: Glutathione S-transferase, C-terminal dom 98.71
KOG3029|consensus 370 98.7
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elo 98.69
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 98.69
cd03195114 GST_C_4 GST_C family, unknown subfamily 4; compose 98.68
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced diff 98.67
PRK1032981 glutaredoxin-like protein; Provisional 98.67
cd00299100 GST_C_family Glutathione S-transferase (GST) famil 98.66
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; c 98.65
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 98.65
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 98.65
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar 98.64
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 98.63
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; com 98.6
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 98.59
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; compose 98.58
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 98.57
PRK1120085 grxA glutaredoxin 1; Provisional 98.56
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 98.55
cd03194114 GST_C_3 GST_C family, unknown subfamily 3; compose 98.51
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase Li 98.5
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 98.49
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 98.49
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 98.45
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 98.44
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 98.4
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 98.36
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 98.35
PHA03050108 glutaredoxin; Provisional 98.35
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 98.34
cd03197149 GST_C_mPGES2 GST_C family; microsomal Prostaglandi 98.31
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 98.28
cd0320598 GST_C_6 GST_C family, unknown subfamily 6; compose 98.21
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 98.17
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 98.12
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 98.1
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 98.08
cd03211126 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me 98.04
KOG4244|consensus 281 97.94
PRK1063883 glutaredoxin 3; Provisional 97.86
cd03212137 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, 97.85
PRK10824115 glutaredoxin-4; Provisional 97.76
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 97.73
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 97.7
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 97.6
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 97.6
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 97.59
KOG3027|consensus257 97.57
PRK1120085 grxA glutaredoxin 1; Provisional 97.55
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 97.47
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 97.47
PRK1032981 glutaredoxin-like protein; Provisional 97.44
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 97.41
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 97.39
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 97.28
KOG1752|consensus104 97.26
PTZ00062204 glutaredoxin; Provisional 97.2
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 97.2
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 97.1
PF1056872 Tom37: Outer mitochondrial membrane transport comp 97.04
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 97.03
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 96.85
PHA03050108 glutaredoxin; Provisional 96.79
cd0303092 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 96.74
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 96.74
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 96.73
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 96.63
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 96.62
PF14834117 GST_C_4: Glutathione S-transferase, C-terminal dom 96.6
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 96.59
COG454585 Glutaredoxin-related protein [Posttranslational mo 96.46
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 96.4
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 96.39
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 96.11
PRK01655131 spxA transcriptional regulator Spx; Reviewed 96.08
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 95.99
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 95.97
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 95.89
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 95.86
PRK01655131 spxA transcriptional regulator Spx; Reviewed 95.82
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 95.55
KOG3028|consensus313 95.42
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 95.35
PRK12559131 transcriptional regulator Spx; Provisional 95.28
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 95.26
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 95.26
PRK13344132 spxA transcriptional regulator Spx; Reviewed 95.25
PRK12559131 transcriptional regulator Spx; Provisional 95.25
PRK10824115 glutaredoxin-4; Provisional 95.24
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p 95.01
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 94.96
PRK13344132 spxA transcriptional regulator Spx; Reviewed 94.94
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 94.81
PRK10026141 arsenate reductase; Provisional 94.78
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p 94.65
COG1393117 ArsC Arsenate reductase and related proteins, glut 94.62
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 94.57
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 94.51
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 94.16
PF11287112 DUF3088: Protein of unknown function (DUF3088); In 94.15
KOG3027|consensus 257 94.14
TIGR01616126 nitro_assoc nitrogenase-associated protein. This m 93.76
KOG2903|consensus 319 93.76
TIGR01616126 nitro_assoc nitrogenase-associated protein. This m 93.65
COG454585 Glutaredoxin-related protein [Posttranslational mo 93.53
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 93.26
COG0278105 Glutaredoxin-related protein [Posttranslational mo 93.05
PRK10853118 putative reductase; Provisional 93.02
PRK10026141 arsenate reductase; Provisional 92.96
PHA0212575 thioredoxin-like protein 92.9
PF1056872 Tom37: Outer mitochondrial membrane transport comp 92.85
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 92.39
PRK10853118 putative reductase; Provisional 92.15
TIGR00014114 arsC arsenate reductase (glutaredoxin). composed o 91.99
TIGR00014114 arsC arsenate reductase (glutaredoxin). composed o 91.94
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s 91.89
KOG1147|consensus 712 91.87
PTZ00062204 glutaredoxin; Provisional 91.83
COG1393117 ArsC Arsenate reductase and related proteins, glut 91.62
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s 91.56
cd03199128 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub 91.42
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 91.3
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 90.7
COG0435 324 ECM4 Predicted glutathione S-transferase [Posttran 90.6
PF04399132 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain 90.46
KOG1752|consensus104 90.2
PF0490899 SH3BGR: SH3-binding, glutamic acid-rich protein; I 90.18
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 83.88
PF03960110 ArsC: ArsC family; InterPro: IPR006660 Several bac 81.79
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 80.35
KOG3028|consensus 313 80.2
>KOG0406|consensus Back     alignment and domain information
Probab=99.96  E-value=1.9e-29  Score=211.29  Aligned_cols=187  Identities=20%  Similarity=0.270  Sum_probs=147.1

Q ss_pred             CCCceEEEeccCChHHHHHHHHHHhcCCCeEEeecccccccCCC-----------CCCceeccCCceeec-hhHhhHhhh
Q psy13369         18 QEGKLRVYSMRFCPYAQRVHLILLAKKIPLTIHVPVTQYRLIGS-----------IFPTWLTTESETHWN-RTCSSYFEQ   85 (311)
Q Consensus        18 ~~~~~~Ly~~~~sp~~~rv~~~L~~~gi~~e~~~~~~~v~~~~~-----------~~p~~l~~~g~~l~E-~~I~~YL~~   85 (311)
                      .++.++||++++|||++|++|+|.+|||+||.+    ++|+..+           ++.|.|+++|.+++| .+|++||++
T Consensus         6 ~~~~vrL~~~w~sPfa~R~~iaL~~KgI~yE~v----eedl~~Ks~~ll~~np~hkKVPvL~Hn~k~i~ESliiveYiDe   81 (231)
T KOG0406|consen    6 EDGTVKLLGMWFSPFAQRVRIALKLKGIPYEYV----EEDLTNKSEWLLEKNPVHKKVPVLEHNGKPICESLIIVEYIDE   81 (231)
T ss_pred             CCCeEEEEEeecChHHHHHHHHHHhcCCceEEE----ecCCCCCCHHHHHhccccccCCEEEECCceehhhHHHHHHHHh
Confidence            348899999999999999999999999999999    7666541           134448899999999 999999999


Q ss_pred             hhccCCCCCCCCCchhHHHhHhHHHHhhchhhhchhHHHHhhhcCCCCCcccHhHHHHhHHHHHHHHhhcCCCcccCCCC
Q psy13369         86 KKRREREMKRSQDPPTQEGKLRVYSMRFCPYAQRLSPAFYKCMMGEGINPSTFGEIVTALEPLEAELKARGTPYLSGSKP  165 (311)
Q Consensus        86 ~~~~~~~~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~~~l~G~~~  165 (311)
                      +|++++ +++|+||.+ |++++.|+++++..+...... .....+.+....+.+++...|..||+.|.+ +++|+.|+++
T Consensus        82 ~w~~~~-~iLP~DPy~-Ra~arfwa~~id~~~~~~~~~-~~~~~~~e~~~~~~~e~~e~l~~lE~el~k-~k~~fgG~~~  157 (231)
T KOG0406|consen   82 TWPSGP-PILPSDPYE-RAQARFWAEYIDKKVFFVGRF-VVAAKGGEEQEAAKEELREALKVLEEELGK-GKDFFGGETI  157 (231)
T ss_pred             hccCCC-CCCCCCHHH-HHHHHHHHHHHHhHHHHHHHH-HHhhcCchHHHHHHHHHHHHHHHHHHHHhc-CCCCCCCCCc
Confidence            998435 899999999 999999999999755332222 111223334445788999999999999973 4589999999


Q ss_pred             chHHHHHHHHHHHhHhhhhhcC-CCccCChhhhhhccCCCCCCCCCCce
Q psy13369        166 GMVDYMIWPWLERLPSLAELAG-PEYALPADKFAQLVSSQDPPTQEGKI  213 (311)
Q Consensus       166 tlADi~l~~~~~~~~~~~~~~~-~~~~~~~~~~p~l~~w~~~~~~~~~~  213 (311)
                      ++.||+++|++.++.......+ .++ .+.+.+|+|.+|.+++.....+
T Consensus       158 G~vDi~~~p~~~~~~~~~~~~~~~~~-~~~~~~P~L~~W~~~~~~~~~V  205 (231)
T KOG0406|consen  158 GFVDIAIGPSFERWLAVLEKFGGVKF-IIEEETPKLIKWIKRMKEDEAV  205 (231)
T ss_pred             CHhhhhHHhhHHHHHHHHHHhcCccc-CCCCCCccHHHHHHHHhcChhH
Confidence            9999999999988766553322 222 4567899999999987665544



>KOG0868|consensus Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>KOG0867|consensus Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>KOG0868|consensus Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>KOG0406|consensus Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>KOG0867|consensus Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>KOG1695|consensus Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>KOG1422|consensus Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>KOG4420|consensus Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>KOG1695|consensus Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>KOG4420|consensus Back     alignment and domain information
>KOG3029|consensus Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>KOG2903|consensus Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>KOG1422|consensus Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>KOG4244|consensus Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha Back     alignment and domain information
>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B Back     alignment and domain information
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B Back     alignment and domain information
>KOG3029|consensus Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>KOG4244|consensus Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>KOG3027|consensus Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>KOG1752|consensus Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>KOG3028|consensus Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PF11287 DUF3088: Protein of unknown function (DUF3088); InterPro: IPR021439 This family of proteins with unknown function appears to be restricted to Proteobacteria Back     alignment and domain information
>KOG3027|consensus Back     alignment and domain information
>TIGR01616 nitro_assoc nitrogenase-associated protein Back     alignment and domain information
>KOG2903|consensus Back     alignment and domain information
>TIGR01616 nitro_assoc nitrogenase-associated protein Back     alignment and domain information
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10853 putative reductase; Provisional Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>PRK10853 putative reductase; Provisional Back     alignment and domain information
>TIGR00014 arsC arsenate reductase (glutaredoxin) Back     alignment and domain information
>TIGR00014 arsC arsenate reductase (glutaredoxin) Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>KOG1147|consensus Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>KOG1752|consensus Back     alignment and domain information
>PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>KOG3028|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
1eem_A 241 Glutathione Transferase From Homo Sapiens Length = 2e-23
3lfl_A 240 Crystal Structure Of Human Glutathione Transferase 2e-23
3qag_A 239 Human Glutathione Transferase O2 With Glutathione - 3e-23
3vln_A 241 Human Glutathione Transferase O1-1 C32s Mutant In C 3e-22
3rbt_A 246 Crystal Structure Of Glutathione S-Transferase Omeg 3e-12
4ags_A 471 Leishmania Tdr1 - A Unique Trimeric Glutathione Tra 3e-07
4hoj_A 210 Crystal Structure Of Glutathione Transferase Homolo 4e-06
3lxz_A 229 Structure Of Probable Glutathione S-Transferase(Pp0 1e-04
3lyk_A 216 Structure Of Stringent Starvation Protein A Homolog 2e-04
3lyp_A 215 Structure Of Stringent Starvation Protein A Homolog 3e-04
1gwc_A 230 The Structure Of A Tau Class Glutathione S-Transfer 4e-04
3ubk_A 242 Crystal Structure Of Glutathione Transferase (Targe 7e-04
>pdb|1EEM|A Chain A, Glutathione Transferase From Homo Sapiens Length = 241 Back     alignment and structure

Iteration: 1

Score = 106 bits (265), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 52/106 (49%), Positives = 70/106 (66%), Gaps = 2/106 (1%) Query: 207 PTQEGKIRVYSMRFCPYAQRVHLILLAKKIPHDPVFINLNEKPEWYVSSVPTGKVPALK- 265 P EG IR+YSMRFCP+A+R L+L AK I H+ + INL KPEW+ P G VP L+ Sbjct: 18 PVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLEN 77 Query: 266 SEGSILYESLIISDYLDEKYEGNRKLIASSPLQRALDRIFLETFGK 311 S+G ++YES I +YLDE Y G +KL+ P ++A ++ LE F K Sbjct: 78 SQGQLIYESAITCEYLDEAYPG-KKLLPDDPYEKACQKMILELFSK 122
>pdb|3LFL|A Chain A, Crystal Structure Of Human Glutathione Transferase Omega 1, Delta 155 Length = 240 Back     alignment and structure
>pdb|3QAG|A Chain A, Human Glutathione Transferase O2 With Glutathione -New Crystal Form Length = 239 Back     alignment and structure
>pdb|3VLN|A Chain A, Human Glutathione Transferase O1-1 C32s Mutant In Complex With Ascorbic Acid Length = 241 Back     alignment and structure
>pdb|3RBT|A Chain A, Crystal Structure Of Glutathione S-Transferase Omega 3 From The Silkworm Bombyx Mori Length = 246 Back     alignment and structure
>pdb|4AGS|A Chain A, Leishmania Tdr1 - A Unique Trimeric Glutathione Transferase Length = 471 Back     alignment and structure
>pdb|4HOJ|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Neisseria Gonorrhoeae, Target Efi-501841, With Bound Glutathione Length = 210 Back     alignment and structure
>pdb|3LXZ|A Chain A, Structure Of Probable Glutathione S-Transferase(Pp0183) From Pseudomonas Putida Length = 229 Back     alignment and structure
>pdb|3LYK|A Chain A, Structure Of Stringent Starvation Protein A Homolog From Haemophilus Influenzae Length = 216 Back     alignment and structure
>pdb|3LYP|A Chain A, Structure Of Stringent Starvation Protein A Homolog From Pseudomonas Fluorescens Length = 215 Back     alignment and structure
>pdb|1GWC|A Chain A, The Structure Of A Tau Class Glutathione S-Transferase From Wheat, Active In Herbicide Detoxification Length = 230 Back     alignment and structure
>pdb|3UBK|A Chain A, Crystal Structure Of Glutathione Transferase (Target Efi-501770) From Leptospira Interrogans Length = 242 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 4e-39
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 8e-33
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 8e-13
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 1e-07
3rbt_A 246 Glutathione transferase O1; glutathione S-transfer 1e-34
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 1e-20
3vln_A 241 GSTO-1, glutathione S-transferase omega-1; GST fol 2e-34
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 2e-11
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 2e-07
3q18_A 239 GSTO-2, glutathione S-transferase omega-2; glutath 2e-34
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 2e-10
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 1e-07
3lyk_A 216 Stringent starvation protein A homolog; structural 2e-31
3lyk_A216 Stringent starvation protein A homolog; structural 2e-07
3lyk_A216 Stringent starvation protein A homolog; structural 9e-05
1yy7_A 213 SSPA, stringent starvation protein A; GST fold, tr 2e-30
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 1e-07
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 1e-04
3lyp_A 215 Stringent starvation protein A; structural genomic 3e-30
3lyp_A215 Stringent starvation protein A; structural genomic 2e-06
3lyp_A215 Stringent starvation protein A; structural genomic 9e-05
2vo4_A 219 2,4-D inducible glutathione S-transferase; herbici 4e-29
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 2e-06
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 2e-05
1gwc_A 230 Glutathione S-transferase TSI-1; herbicide detoxif 2e-28
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 7e-14
4dej_A 231 Glutathione S-transferase related protein; transfe 6e-28
4dej_A231 Glutathione S-transferase related protein; transfe 8e-07
4dej_A231 Glutathione S-transferase related protein; transfe 1e-04
3fy7_A 250 Chloride intracellular channel protein 3; GST, glu 1e-25
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 1e-09
1oyj_A 231 Glutathione S-transferase; herbicide detoxificatio 3e-25
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 9e-13
2r4v_A 247 XAP121, chloride intracellular channel protein 2; 5e-24
2r4v_A247 XAP121, chloride intracellular channel protein 2; 2e-08
1k0m_A 241 CLIC1, NCC27, chloride intracellular channel prote 4e-22
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 1e-09
3ubk_A 242 Glutathione transferase; GSH binding; 1.95A {Lepto 4e-22
2cz2_A 223 Maleylacetoacetate isomerase; structural genomics, 1e-21
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 2e-05
2ahe_A 267 Chloride intracellular channel protein 4; glutathi 2e-21
2ahe_A267 Chloride intracellular channel protein 4; glutathi 2e-07
3lxz_A 229 Glutathione S-transferase family protein; structur 1e-20
3m0f_A 213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 1e-20
3cbu_A 214 Probable GST-related protein; thioredoxin fold, GS 6e-20
3ir4_A 218 Glutaredoxin 2; glutathione, IDP00895, structural 2e-19
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 1e-09
3r2q_A 202 Uncharacterized GST-like protein YIBF; transferase 3e-19
2v6k_A 214 Maleylpyruvate isomerase; glutathione-S-transferas 3e-18
2yv7_A 260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 4e-18
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 1e-05
3tou_A 226 Glutathione S-transferase protein; GSH binding sit 6e-18
3niv_A 222 Glutathione S-transferase; structural genomics, PS 1e-17
3ibh_A 233 GST-II, saccharomyces cerevisiae GTT2; glutathione 1e-16
3bby_A 215 Uncharacterized GST-like protein YFCF; NP_416804.1 1e-15
1e6b_A 221 Glutathione S-transferase; 1.65A {Arabidopsis thal 4e-15
3qav_A 243 RHO-class glutathione S-transferase; cytosol; 2.10 8e-15
1z9h_A 290 Membrane-associated prostaglandin E synthase-2; me 1e-12
1ljr_A 244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 4e-12
1gnw_A 211 Glutathione S-transferase; herbicide detoxificatio 2e-11
1axd_A 209 Glutathione S-transferase I; transferase, herbicid 4e-11
2c3n_A 247 Glutathione S-transferase theta 1; glutathione tra 6e-11
3ic8_A 310 Uncharacterized GST-like proteinprotein; glutathio 9e-11
3ay8_A 216 Glutathione S-transferase; GST fold, GST binding, 9e-11
1aw9_A 216 Glutathione S-transferase III; herbicide detoxific 1e-10
3n5o_A 235 Glutathione transferase; seattle structural genomi 1e-10
2imi_A 221 Epsilon-class glutathione S-transferase; HET: GSH; 1e-10
1v2a_A 210 Glutathione transferase GST1-6; glutathione S-tran 2e-09
1r5a_A 218 Glutathione transferase; glutathione S-transferase 1e-08
1pn9_A 209 GST class-delta, glutathione S-transferase 1-6; pr 4e-08
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 9e-08
3ein_A 209 GST class-theta, glutathione S-transferase 1-1; de 9e-08
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 1e-07
4g9h_A 211 Glutathione S-transferase; GST, enzyme function in 2e-07
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 3e-07
2yv9_A 291 Chloride intracellular channel EXC-4; chloride ION 5e-07
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 4e-04
2x64_A 207 Glutathione-S-transferase; detoxification enzyme; 7e-07
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 2e-06
3uar_A 227 Glutathione S-transferase; GSH binding site; HET: 2e-06
3f6d_A 219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 3e-06
3m8n_A 225 Possible glutathione S-transferase; PSI-II, struct 6e-06
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 9e-06
1f2e_A201 Glutathione S-transferase; GST complexed with glut 1e-05
3m3m_A 210 Glutathione S-transferase; PSI-II, structural geno 1e-05
1nhy_A 219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 7e-05
1k3y_A 221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 9e-05
3lsz_A 225 Glutathione S-transferase; xenobiotic, biodegradat 2e-04
2ycd_A 230 Glutathione S-transferase; SOIL bacteria, herbicid 2e-04
4exj_A 238 Uncharacterized protein; transferase-like protein, 3e-04
3ik7_A 222 Glutathione S-transferase A4; human GST A4-4, enzy 7e-04
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
 Score =  142 bits (359), Expect = 4e-39
 Identities = 48/229 (20%), Positives = 73/229 (31%), Gaps = 34/229 (14%)

Query: 116 YAQRLSPAFYKCMMG--EGINPSTFGEIVTALEPLEAELKARGTPYLSGSKPGMVDYMIW 173
                  A +  +     G       +    ++ L A  +  G PY    +  M D  + 
Sbjct: 126 QVGDFIGAAHGLLRDPLSGEKRKAMDDNAAYVDGLLAANQTTG-PYYCDGEFTMADVALV 184

Query: 174 PWLERL-PSLAELAG----------------------------PEYALPADKFAQLVSSQ 204
           P+L RL P+L   AG                                   +    +  S 
Sbjct: 185 PFLVRLKPALMYYAGYDVFCKAPRMKALWAAAAQRASVRETSPTAAQCIENYRHLVPESA 244

Query: 205 DPPTQEGKIRVYSMRFCPYAQRVHLILLAKKIPHDPVFINLNEKPEWYVSSVPTGKVPAL 264
                 G   +YS  FCP+  R  L    +K     V + L+ +PEWY    P   VPAL
Sbjct: 245 PMMGANGGHVLYSNLFCPFVDRARLASELRKFQMHIVEVPLHPQPEWYKYINPRDTVPAL 304

Query: 265 K-SEGSILYESLIISDYLDEKYEGNRKLI-ASSPLQRALDRIFLETFGK 311
               G  ++ES +I  Y+D        L+      +      F+E  G 
Sbjct: 305 FTPSGEAVHESQLIVQYIDCVATKGSALVPRGDAEKEYEVGFFVENAGY 353


>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Length = 290 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 Back     alignment and structure
>4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221 Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238 Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 100.0
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 99.96
4glt_A225 Glutathione S-transferase-like protein; structural 99.95
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 99.95
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 99.95
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 99.95
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 99.95
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 99.95
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 99.95
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 99.95
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 99.94
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 99.94
4gci_A211 Glutathione S-transferase; GST, enzyme function in 99.94
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 99.94
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 99.93
3n5o_A235 Glutathione transferase; seattle structural genomi 99.93
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 99.93
3lyk_A216 Stringent starvation protein A homolog; structural 99.93
3lyp_A215 Stringent starvation protein A; structural genomic 99.93
3niv_A222 Glutathione S-transferase; structural genomics, PS 99.93
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 99.93
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 99.93
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 99.93
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 99.93
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 99.93
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 99.93
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 99.93
4dej_A231 Glutathione S-transferase related protein; transfe 99.93
1r5a_A218 Glutathione transferase; glutathione S-transferase 99.93
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 99.93
3tou_A226 Glutathione S-transferase protein; GSH binding sit 99.93
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 99.93
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 99.92
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 99.92
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 99.92
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 99.92
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 99.92
4ikh_A244 Glutathione S-transferase; enzyme function initiat 99.92
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 99.92
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 99.92
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 99.92
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 99.92
3lxz_A229 Glutathione S-transferase family protein; structur 99.92
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 99.92
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 99.92
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 99.92
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 99.92
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 99.92
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 99.92
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 99.92
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 99.92
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 99.92
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 99.92
1f2e_A201 Glutathione S-transferase; GST complexed with glut 99.92
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 99.92
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 99.91
1axd_A209 Glutathione S-transferase I; transferase, herbicid 99.91
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 99.91
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 99.91
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 99.91
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 99.91
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 99.91
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 99.91
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 99.91
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 99.91
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 99.91
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 99.91
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 99.91
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 99.91
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 99.91
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 99.91
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 99.91
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 99.91
4exj_A238 Uncharacterized protein; transferase-like protein, 99.9
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 99.9
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 99.9
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 99.9
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 99.9
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 99.9
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 99.9
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 99.9
2fhe_A216 GST, glutathione S-transferase; transferase-substr 99.9
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 99.9
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 99.9
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 99.9
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 99.9
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 99.9
4ecj_A244 Glutathione S-transferase; transferase-like protei 99.9
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 99.9
2r4v_A247 XAP121, chloride intracellular channel protein 2; 99.89
2ahe_A267 Chloride intracellular channel protein 4; glutathi 99.89
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 99.89
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 99.89
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 99.89
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 99.89
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 99.89
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 99.88
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 99.88
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 99.88
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 99.88
4hoj_A 210 REGF protein; GST, glutathione S-transferase, enzy 99.87
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 99.87
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 99.87
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 99.87
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 99.86
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 99.86
4glt_A 225 Glutathione S-transferase-like protein; structural 99.86
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 99.85
4hi7_A 228 GI20122; GST, glutathione S-transferase, enzyme fu 99.85
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 99.85
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 99.84
3vk9_A 216 Glutathione S-transferase delta; glutathione bindi 99.84
3lyk_A 216 Stringent starvation protein A homolog; structural 99.83
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 99.83
1yy7_A 213 SSPA, stringent starvation protein A; GST fold, tr 99.83
3r2q_A 202 Uncharacterized GST-like protein YIBF; transferase 99.82
4gf0_A 215 Glutathione S-transferase; GST, enzyme function in 99.82
3lyp_A 215 Stringent starvation protein A; structural genomic 99.82
4g10_A 265 Glutathione S-transferase homolog; thioredoxin fol 99.82
3q18_A 239 GSTO-2, glutathione S-transferase omega-2; glutath 99.82
3rbt_A 246 Glutathione transferase O1; glutathione S-transfer 99.82
3bby_A 215 Uncharacterized GST-like protein YFCF; NP_416804.1 99.82
4dej_A 231 Glutathione S-transferase related protein; transfe 99.82
2cz2_A 223 Maleylacetoacetate isomerase; structural genomics, 99.82
1oyj_A 231 Glutathione S-transferase; herbicide detoxificatio 99.81
1gwc_A 230 Glutathione S-transferase TSI-1; herbicide detoxif 99.81
3m0f_A 213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 99.81
2vo4_A 219 2,4-D inducible glutathione S-transferase; herbici 99.81
1e6b_A 221 Glutathione S-transferase; 1.65A {Arabidopsis thal 99.81
3niv_A 222 Glutathione S-transferase; structural genomics, PS 99.81
3vln_A 241 GSTO-1, glutathione S-transferase omega-1; GST fol 99.81
2v6k_A 214 Maleylpyruvate isomerase; glutathione-S-transferas 99.81
3ay8_A 216 Glutathione S-transferase; GST fold, GST binding, 99.81
4iel_A 229 Glutathione S-transferase, N-terminal domain PROT; 99.81
4id0_A 214 Glutathione S-transferase-like protein YIBF; GST, 99.81
3tou_A 226 Glutathione S-transferase protein; GSH binding sit 99.81
2imi_A 221 Epsilon-class glutathione S-transferase; HET: GSH; 99.8
3qav_A 243 RHO-class glutathione S-transferase; cytosol; 2.10 99.8
1gnw_A 211 Glutathione S-transferase; herbicide detoxificatio 99.8
1ljr_A 244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 99.8
3lxz_A 229 Glutathione S-transferase family protein; structur 99.8
3ein_A 209 GST class-theta, glutathione S-transferase 1-1; de 99.8
1r5a_A 218 Glutathione transferase; glutathione S-transferase 99.79
1yq1_A 208 Glutathione S-transferase; nematoda, structural ge 99.79
1axd_A 209 Glutathione S-transferase I; transferase, herbicid 99.79
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 99.79
3n5o_A 235 Glutathione transferase; seattle structural genomi 99.79
3ibh_A 233 GST-II, saccharomyces cerevisiae GTT2; glutathione 99.79
3ubk_A 242 Glutathione transferase; GSH binding; 1.95A {Lepto 99.79
4gci_A 211 Glutathione S-transferase; GST, enzyme function in 99.79
2ws2_A 204 NU-class GST, glutathione S-transferase; parasite, 99.79
2c3n_A 247 Glutathione S-transferase theta 1; glutathione tra 99.79
1pn9_A 209 GST class-delta, glutathione S-transferase 1-6; pr 99.78
3cbu_A 214 Probable GST-related protein; thioredoxin fold, GS 99.78
4hz4_A 217 Glutathione-S-transferase; enzyme function initiat 99.78
2on5_A 206 Nagst-2, Na glutathione S-transferase 2; hookworm; 99.78
3f6d_A 219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 99.78
1zl9_A 207 GST class-sigma, glutathione S-transferase 5; glut 99.78
2cvd_A 198 Glutathione-requiring prostaglandin D synthase; gl 99.78
1v2a_A 210 Glutathione transferase GST1-6; glutathione S-tran 99.77
3lsz_A 225 Glutathione S-transferase; xenobiotic, biodegradat 99.77
3m3m_A 210 Glutathione S-transferase; PSI-II, structural geno 99.77
1k0d_A 260 URE2 protein; nitrate assimilation, structural gen 99.77
1aw9_A 216 Glutathione S-transferase III; herbicide detoxific 99.77
2gsq_A 202 Squid GST, glutathione S-transferase; squid digest 99.77
1tw9_A 206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 99.77
2wb9_A 211 Glutathione transferase sigma class; thioredoxin f 99.77
4hz2_A 230 Glutathione S-transferase domain; glutathione,enzy 99.77
2x64_A 207 Glutathione-S-transferase; detoxification enzyme; 99.76
2on7_A 206 Nagst-1, Na glutathione S-transferase 1; hookworm; 99.76
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 99.76
3m8n_A 225 Possible glutathione S-transferase; PSI-II, struct 99.76
1okt_A 211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 99.76
1nhy_A 219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 99.76
1tu7_A 208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 99.76
2hnl_A 225 Glutathione S-transferase 1; prostaglandin synthas 99.76
1m0u_A 249 GST2 gene product; flight muscle protein, sigma, t 99.76
2ycd_A 230 Glutathione S-transferase; SOIL bacteria, herbicid 99.76
3gx0_A 215 GST-like protein YFCG; transferase, glutathione, g 99.76
1f2e_A201 Glutathione S-transferase; GST complexed with glut 99.75
4ikh_A 244 Glutathione S-transferase; enzyme function initiat 99.75
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 99.75
2a2r_A 210 Glutathione S-transferase P; detoxification, nitri 99.75
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 99.75
1k0m_A 241 CLIC1, NCC27, chloride intracellular channel prote 99.75
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 99.75
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 99.75
2ahe_A 267 Chloride intracellular channel protein 4; glutathi 99.74
1k3y_A 221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 99.74
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.74
4ecj_A 244 Glutathione S-transferase; transferase-like protei 99.74
1vf1_A 229 Glutathione S-transferase 3; detoxification; HET: 99.74
1oe8_A 211 Glutathione S-transferase; schistosomiasis, detoxi 99.74
3uar_A 227 Glutathione S-transferase; GSH binding site; HET: 99.74
1b48_A 221 GST, mgsta4-4, protein (glutathione S-transferase) 99.73
3ic8_A 310 Uncharacterized GST-like proteinprotein; glutathio 99.73
4exj_A 238 Uncharacterized protein; transferase-like protein, 99.73
2r4v_A 247 XAP121, chloride intracellular channel protein 2; 99.73
3gtu_B 224 Glutathione S-transferase; conjugation, detoxifica 99.72
1gsu_A 219 GST, CGSTM1-1, class-MU glutathione S-transferase; 99.72
3ik7_A 222 Glutathione S-transferase A4; human GST A4-4, enzy 99.71
2fhe_A 216 GST, glutathione S-transferase; transferase-substr 99.7
2c4j_A 218 Glutathione S-transferase MU 2; glutathione transf 99.7
3iso_A 218 Putative glutathione transferase; GST; HET: GSH; 1 99.7
3h1n_A 252 Probable glutathione S-transferase; APC84167, bord 99.7
3ir4_A 218 Glutaredoxin 2; glutathione, IDP00895, structural 99.69
4f03_A 253 Glutathione transferase; GST fold; 1.80A {Phaneroc 99.69
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 99.69
1dug_A 234 Chimera of glutathione S-transferase-synthetic lin 99.69
3c8e_A 288 YGHU, glutathione S-transferase homologue; glutath 99.69
1b8x_A 280 Protein (AML-1B); nuclear matrix targeting signal 99.66
2fno_A 248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 99.65
1bg5_A 254 MAB, fusion protein of alpha-Na,K-ATPase with glut 99.65
3fy7_A 250 Chloride intracellular channel protein 3; GST, glu 99.62
2yv7_A 260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 99.61
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 99.57
1z9h_A 290 Membrane-associated prostaglandin E synthase-2; me 99.57
2yv9_A 291 Chloride intracellular channel EXC-4; chloride ION 99.52
3m1g_A 362 Putative glutathione S-transferase; ECM4-like subf 99.44
3ppu_A 352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 99.43
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.38
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 99.22
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 99.17
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 99.09
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 99.08
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 99.04
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 99.01
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 98.99
4fqu_A 313 Putative glutathione transferase; glutathionyl-hyd 98.88
2hqt_A124 GU4 nucleic-binding protein 1; GST-fold, biosynthe 98.82
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 98.81
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 98.8
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 98.74
4g0i_A 328 Protein YQJG; glutathionyl-hydroquinone reductase, 98.7
2hra_A 209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 98.67
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 98.65
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 98.6
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 98.56
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 98.41
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 98.4
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 98.38
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 98.38
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 98.36
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 98.35
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 98.34
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 98.32
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 98.3
1kte_A105 Thioltransferase; redox-active center, electron tr 98.3
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 98.25
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 98.25
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 98.24
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 98.21
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 98.2
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 98.2
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 98.19
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 98.19
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 98.14
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 98.14
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 98.1
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 98.1
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 98.09
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 98.06
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 98.06
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 97.99
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 97.89
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 97.81
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 97.79
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 97.75
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 97.69
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 97.61
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 97.59
1ttz_A87 Conserved hypothetical protein; structural genomic 97.55
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 97.51
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 97.5
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 97.48
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 97.46
1z3e_A132 Regulatory protein SPX; bacterial transcription re 97.38
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 97.26
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 97.2
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 97.19
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 97.17
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 97.16
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 97.07
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 97.04
1kte_A105 Thioltransferase; redox-active center, electron tr 96.99
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 96.95
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 96.94
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 96.87
3gkx_A120 Putative ARSC family related protein; ARSC family 96.82
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 96.82
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 96.78
3rdw_A121 Putative arsenate reductase; structural genomics, 96.73
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 96.73
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 96.73
1z3e_A132 Regulatory protein SPX; bacterial transcription re 96.73
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 96.72
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 96.68
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 96.66
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 96.62
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 96.55
3fz4_A120 Putative arsenate reductase; APC61768, structural 96.52
3l78_A120 Regulatory protein SPX; transcription, transcripti 96.49
3f0i_A119 Arsenate reductase; structural genomics, IDP01300, 96.49
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 96.45
3f0i_A119 Arsenate reductase; structural genomics, IDP01300, 96.44
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 96.42
3l78_A120 Regulatory protein SPX; transcription, transcripti 96.41
3gkx_A120 Putative ARSC family related protein; ARSC family 96.4
3rdw_A121 Putative arsenate reductase; structural genomics, 96.27
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 96.22
3fz4_A120 Putative arsenate reductase; APC61768, structural 96.19
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 96.19
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 96.17
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 96.1
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 95.86
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 95.73
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 95.34
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 95.31
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 94.49
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 94.45
2axo_A 270 Hypothetical protein ATU2684; alpha beta protein., 94.32
1ttz_A87 Conserved hypothetical protein; structural genomic 93.59
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 92.98
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 92.47
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 92.15
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 92.1
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 91.96
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 90.16
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 89.06
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 88.75
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 87.64
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 86.17
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 85.46
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 85.0
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 83.94
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 83.6
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 82.45
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 82.09
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 81.44
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 80.92
4euy_A105 Uncharacterized protein; structural genomics, PSI- 80.2
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
Probab=100.00  E-value=8.8e-43  Score=330.42  Aligned_cols=281  Identities=19%  Similarity=0.272  Sum_probs=222.7

Q ss_pred             CCCceEEEeccCChHHHHHHHHHHhcCCCeEEee-c--------ccccccCCCCCCceeccCC---ceeec-hhHhhHhh
Q psy13369         18 QEGKLRVYSMRFCPYAQRVHLILLAKKIPLTIHV-P--------VTQYRLIGSIFPTWLTTES---ETHWN-RTCSSYFE   84 (311)
Q Consensus        18 ~~~~~~Ly~~~~sp~~~rv~~~L~~~gi~~e~~~-~--------~~~v~~~~~~~p~~l~~~g---~~l~E-~~I~~YL~   84 (311)
                      ....++||+++.||+|+||+++|+++||+|+.+. +        +..+||.+  +.|.|+++|   .+|+| .+|++||+
T Consensus        23 ~~~~~~Ly~~~~sp~~~~v~~~L~~~gi~~e~~~v~~~~~~~~~~~~~nP~g--~vP~L~~~~~~g~~l~eS~aI~~yL~  100 (471)
T 4ags_A           23 AARALKLYVSATCPFCHRVEIVAREKQVSYDRVAVGLREEMPQWYKQINPRE--TVPTLEVGNADKRFMFESMLIAQYLD  100 (471)
T ss_dssp             --CCEEEEECTTCHHHHHHHHHHHHTTCCCEEEECCCGGGCCHHHHHHCTTC--CSCEEEECSSSCEEEESHHHHHHHHH
T ss_pred             CCCceEEECCCCCchHHHHHHHHHHcCCCCEEEEeCCCCCccHHHHhhCCCC--ccCeEEECCcCeEEEecHHHHHHHHH
Confidence            3457999999999999999999999999998873 1        22345555  556677665   99999 99999999


Q ss_pred             hhhccCCCCCCCCCchhHHHhHhHHHHhhchhhhchhHHHHhhhcCCCCCcccHhHHHHhHHHHHHHHhhc--CCCcccC
Q psy13369         85 QKKRREREMKRSQDPPTQEGKLRVYSMRFCPYAQRLSPAFYKCMMGEGINPSTFGEIVTALEPLEAELKAR--GTPYLSG  162 (311)
Q Consensus        85 ~~~~~~~~~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~--~~~~l~G  162 (311)
                      ++|+.++ .|+|.++.+ ++++++|++++.+.+...    ...... ....+..+.+.+.++.+|+.|.++  +++|++|
T Consensus       101 ~~~~~~~-~L~p~~~~~-ra~~~~~~~~~~~~~~~~----~~~~~~-~~~~~~~~~~~~~l~~l~~~L~~~l~~~~~l~G  173 (471)
T 4ags_A          101 NSGAPAG-ALMGSSAAQ-RHQIEFFLAQVGDFIGAA----HGLLRD-PLSGEKRKAMDDNAAYVDGLLAANQTTGPYYCD  173 (471)
T ss_dssp             HTSSSTT-GGGCSSHHH-HHHHHHHHHHHHHHHHHH----HHHHTS-TTCHHHHHHHHHHHHHHHHHHHHHCSSCSBTBB
T ss_pred             HhcCCCC-CCCCCCHHH-HHHHHHHHHHHhhhhHHH----HHHhcC-cccHHHHHHHHHHHHHHHHHHHhccCCCCeeCC
Confidence            9983144 699998888 999999998877644332    222222 223345678888899999988754  5689999


Q ss_pred             CCCchHHHHHHHHHHHhHhh-hhhcCCCccCChhhhhhccCCCCCC-------------------------------CCC
Q psy13369        163 SKPGMVDYMIWPWLERLPSL-AELAGPEYALPADKFAQLVSSQDPP-------------------------------TQE  210 (311)
Q Consensus       163 ~~~tlADi~l~~~~~~~~~~-~~~~~~~~~~~~~~~p~l~~w~~~~-------------------------------~~~  210 (311)
                      +++|+|||++++++.++... ....+.+   ..+.||+|.+|.+++                               ..+
T Consensus       174 ~~~t~ADi~l~~~l~~~~~~~~~~~~~~---~~~~~p~l~~w~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~  250 (471)
T 4ags_A          174 GEFTMADVALVPFLVRLKPALMYYAGYD---VFCKAPRMKALWAAAAQRASVRETSPTAAQCIENYRHLVPESAPMMGAN  250 (471)
T ss_dssp             TBCCHHHHHHHHHHHHHHHHHHHHHSCC---TTTTCHHHHHHHHHHTTSHHHHTTCCCHHHHHHHHGGGSCTTSTTGGGT
T ss_pred             CCCCHhHHHHHHHHHHHHHHhhhhcCCc---ccCCChHHHHHHHHHhcChHHHHhccCHHHHHHHHHhhccccCCCCCCC
Confidence            99999999999999998642 1111111   124577777766531                               123


Q ss_pred             CceeeeccCCCchHHHHHHHHHhCCCCceEEEccCCCCchhHHhhCCCCcccEEE-eCCeeecCHHHHHHHHHHhcCCCC
Q psy13369        211 GKIRVYSMRFCPYAQRVHLILLAKKIPHDPVFINLNEKPEWYVSSVPTGKVPALK-SEGSILYESLIISDYLDEKYEGNR  289 (311)
Q Consensus       211 ~~~~Ly~~~~~~~~~~~r~~L~~~gi~~~~~~v~~~~~~~~~~~~~p~~~vP~l~-~~~~~l~es~aI~~yL~~~~~~~~  289 (311)
                      .+++||+++.||+|+++|++|+++||+|+.+.+++.++.++|++.||.|+||+|+ ++|.+|+||.+|++||++++++..
T Consensus       251 ~~~~L~~~~~sp~~~rv~~~L~~~gi~y~~~~v~~~~~~~~~~~~~P~g~vP~L~~~~g~~l~eS~aI~~yL~~~~~~~~  330 (471)
T 4ags_A          251 GGHVLYSNLFCPFVDRARLASELRKFQMHIVEVPLHPQPEWYKYINPRDTVPALFTPSGEAVHESQLIVQYIDCVATKGS  330 (471)
T ss_dssp             TSCEEEECTTCHHHHHHHHHHHHTTCCCEEEECCCSSCCTTHHHHCTTCCSCEEECTTSCEEESHHHHHHHHHHHCCSSC
T ss_pred             CcEEEEecCCCchHHHHHHHHHHCCCCcEEEEecCCcCcHHHHHhCCCCCcCeEEeCCCcEeecHHHHHHHHHhccCCCC
Confidence            4689999999999999999999999999999999998899999999999999999 699999999999999999885333


Q ss_pred             CCCCC-CHHHHHHHHHHHHHhc
Q psy13369        290 KLIAS-SPLQRALDRIFLETFG  310 (311)
Q Consensus       290 ~l~~~-~~~~~a~~~~~~~~~~  310 (311)
                      .|+|. ++.+++.++.|+.+++
T Consensus       331 ~L~p~~~~~~~a~~~~~~~~~~  352 (471)
T 4ags_A          331 ALVPRGDAEKEYEVGFFVENAG  352 (471)
T ss_dssp             CSSCTTCHHHHHHHHHHHHHHH
T ss_pred             CCCCCCChHHHHHHHHHHHHHh
Confidence            89999 9999999999998865



>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 Back     alignment and structure
>3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 311
d1eema298 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa 5e-19
d1eema298 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa 7e-07
d1oyja284 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ 1e-16
d1oyja284 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ 0.001
d1e6ba280 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress 1e-13
d1e6ba280 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress 0.003
d1axda280 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), 3e-13
d1k0ma286 c.47.1.5 (A:6-91) Chloride intracellular channel 1 7e-13
d1aw9a281 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), 2e-12
d1gwca283 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii 2e-12
d1gwca283 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii 0.003
d1r5aa285 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph 4e-12
d1jlva284 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph 2e-11
d1fw1a283 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi 2e-11
d1g7oa275 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli 2e-11
d1gnwa284 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( 3e-10
d1ljra279 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap 9e-10
d1v2aa283 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph 4e-09
d1z9ha2113 c.47.1.5 (A:100-212) Microsomal prostaglandin E sy 2e-08
d1b48a278 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musc 3e-08
d2a2ra277 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien 2e-07
d1k0da292 c.47.1.5 (A:109-200) Yeast prion protein ure2p, ni 7e-07
d2cvda274 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sap 7e-07
d1k3ya279 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sap 8e-07
d1n2aa280 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli 8e-07
d1f2ea280 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas pau 1e-06
d1gula277 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sap 3e-06
d1tu7a277 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulu 4e-06
d1m0ua276 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Dr 8e-06
d1pmta280 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabili 1e-05
d2c4ja284 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapien 1e-05
d1okta285 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasm 7e-05
d1tw9a277 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides 2e-04
d1fhea280 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepati 6e-04
d1nm3a174 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hyb 7e-04
d1v2aa1125 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano 8e-04
d1oe8a281 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Sc 0.002
d2gsqa275 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastre 0.002
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione S-transferase (GST), N-terminal domain
domain: Class omega GST
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 78.5 bits (193), Expect = 5e-19
 Identities = 45/89 (50%), Positives = 59/89 (66%), Gaps = 1/89 (1%)

Query: 202 SSQDPPTQEGKIRVYSMRFCPYAQRVHLILLAKKIPHDPVFINLNEKPEWYVSSVPTGKV 261
           S+   P  EG IR+YSMRFCP+A+R  L+L AK I H+ + INL  KPEW+    P G V
Sbjct: 9   SAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLV 68

Query: 262 PALK-SEGSILYESLIISDYLDEKYEGNR 289
           P L+ S+G ++YES I  +YLDE Y G +
Sbjct: 69  PVLENSQGQLIYESAITCEYLDEAYPGKK 97


>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 83 Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 83 Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 113 Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 92 Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 80 Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 77 Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 80 Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 85 Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 77 Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 80 Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Length = 74 Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125 Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 81 Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 75 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 99.85
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 99.84
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 99.84
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.84
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 99.83
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.83
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.83
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.82
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.82
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.82
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.8
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 99.8
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 99.79
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 99.77
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.75
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.74
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 99.74
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 99.74
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.73
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.72
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.71
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.7
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.69
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.69
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.66
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.66
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 99.66
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.65
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 99.64
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 99.64
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 99.62
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.62
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 99.62
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 99.61
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 99.61
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.61
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 99.6
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.6
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 99.59
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 99.58
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.56
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.56
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.56
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.56
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.55
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 99.54
d1fw1a1125 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.54
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 99.5
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 99.47
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.47
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.46
d1v2aa1125 Class delta GST {Mosquito (Anopheles dirus b), iso 99.45
d1oe8a281 Class alpha GST {Blood fluke (Schistosoma haematob 99.44
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.44
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 99.4
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.4
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 99.39
d1jlwa1127 Class delta GST {Mosquito (Anopheles dirus b), iso 99.38
d1jlva1123 Class delta GST {Mosquito (Anopheles dirus b), iso 99.38
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.36
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 99.34
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 99.33
d1r5aa1129 Class delta GST {Mosquito (Anopheles dirus b), iso 99.33
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 99.32
d1b48a1143 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.31
d1ljra1165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.31
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.3
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.29
d1tw9a1129 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.28
d1gula1140 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.28
d1k3ya1142 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.27
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.27
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.26
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.24
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 99.24
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.24
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 99.23
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.19
d2cvda1124 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.18
d1k0da1151 Yeast prion protein ure2p, nitrogen regulation fra 99.17
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 99.17
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.16
d2gsqa1127 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.15
d1m0ua1127 Class sigma GST {Fruit fly (Drosophila melanogaste 99.13
d3gtub1140 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.07
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.07
d2c4ja1133 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1gsua1133 Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 99.05
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.05
d2a2ra1132 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.04
d2gsta1133 Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 99.04
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 99.03
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 98.99
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 98.96
d1duga1140 Class alpha GST {Schistosoma japonicum [TaxId: 618 98.95
d1okta1126 Pf GST {Malarial parasite (Plasmodium falciparum) 98.95
d2fhea1136 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 98.92
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 98.9
d1oe8a1123 Class alpha GST {Blood fluke (Schistosoma haematob 98.9
d1oe8a281 Class alpha GST {Blood fluke (Schistosoma haematob 98.87
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 98.83
d1tu7a1131 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 98.76
d2hrkb1118 GU4 nucleic-binding protein 1, Arc1p {Baker's yeas 98.74
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 98.7
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 98.69
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 98.62
d1k0ma1149 Chloride intracellular channel 1 (clic1) {Human (H 98.6
d1z9ha1161 Microsomal prostaglandin E synthase-2 {Crab-eating 98.18
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 98.12
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 98.1
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 97.91
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 97.89
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 97.89
d1wjka_100 Thioredoxin-like structure containing protein C330 97.81
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 97.78
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 97.36
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 97.34
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 97.29
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 97.12
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 96.74
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 96.02
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 95.97
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 95.88
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 95.24
d1wjka_100 Thioredoxin-like structure containing protein C330 94.58
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 94.42
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 94.34
d1rw1a_114 Hypothetical protein PA3664 (YffB) {Pseudomonas ae 94.28
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 94.16
d1rw1a_114 Hypothetical protein PA3664 (YffB) {Pseudomonas ae 93.46
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 93.18
d1j9ba_138 Arsenate reductase ArsC {Escherichia coli [TaxId: 90.98
d1j9ba_138 Arsenate reductase ArsC {Escherichia coli [TaxId: 90.72
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 90.06
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 88.24
d2fnoa1149 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 87.99
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 86.44
d1g7oa1140 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 85.24
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 80.72
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione S-transferase (GST), N-terminal domain
domain: Class delta GST
species: Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]
Probab=99.85  E-value=1.1e-21  Score=139.19  Aligned_cols=81  Identities=25%  Similarity=0.328  Sum_probs=74.7

Q ss_pred             eeeeccCCCchHHHHHHHHHhCCCCceEEEccCC---CCchhHHhhCCCCcccEEEeCCeeecCHHHHHHHHHHhcCCCC
Q psy13369        213 IRVYSMRFCPYAQRVHLILLAKKIPHDPVFINLN---EKPEWYVSSVPTGKVPALKSEGSILYESLIISDYLDEKYEGNR  289 (311)
Q Consensus       213 ~~Ly~~~~~~~~~~~r~~L~~~gi~~~~~~v~~~---~~~~~~~~~~p~~~vP~l~~~~~~l~es~aI~~yL~~~~~~~~  289 (311)
                      ++||+.+.|++|++||++|.++|++|+.+.|++.   ++.++|+++||.|+||+|+++|..|+||.||++||+++|+.++
T Consensus         1 mkLY~~~~S~~~~~v~~~l~e~gi~~e~~~v~~~~~~~~~~~~~~~nP~g~vP~L~d~~~~l~ES~aI~~yL~~~~~~~~   80 (84)
T d1jlva2           1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTNLMAGEHMKPEFLKINPQHCIPTLVDNGFALWESRAICTYLAEKYGKDD   80 (84)
T ss_dssp             CEEEECTTCHHHHHHHHHHHHTTCCCEEEECCGGGTGGGSHHHHHHCTTCCSCEEEETTEEEESHHHHHHHHHHHHCCCG
T ss_pred             CEEEcCCCCHHHHHHHHHHHHcCCCCEEEEecCCCCccCCHHHHHHhccccCCEEEECCEEEEcHHHHHHHHHHHcCCCC
Confidence            5899999999999999999999999999999876   4677999999999999999999999999999999999997664


Q ss_pred             CCCC
Q psy13369        290 KLIA  293 (311)
Q Consensus       290 ~l~~  293 (311)
                      .|+|
T Consensus        81 ~L~P   84 (84)
T d1jlva2          81 KLYP   84 (84)
T ss_dssp             GGSC
T ss_pred             CCCC
Confidence            6765



>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure