Diaphorina citri psyllid: psy1336


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MVFIIDSRLELGGSNSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTANETYLSLNMLSLCDIVLNHTANETFDLIV
cEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccEEEEEEEEccccccccccccccccHHHHHHHHHcccccccc
MVFIIDSRLELGGSNSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTANETYLSLNMLSLCDIVLNHTANETFDLIV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFIIDSRLELGGSNSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTANETYLSLNMLSLCDIVLNHTANETFDLIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glycogen debranching enzyme Multifunctional enzyme acting as 1,4-alpha-D-glucan:1,4-alpha-D-glucan 4-alpha-D-glycosyltransferase and amylo-1,6-glucosidase in glycogen degradation.confidentP35573
Glycogen debranching enzyme Multifunctional enzyme acting as 1,4-alpha-D-glucan:1,4-alpha-D-glucan 4-alpha-D-glycosyltransferase and amylo-1,6-glucosidase in glycogen degradation.confidentA8BQB4
Glycogen debranching enzyme Multifunctional enzyme acting as 1,4-alpha-D-glucan:1,4-alpha-D-glucan 4-alpha-D-glycosyltransferase and amylo-1,6-glucosidase in glycogen degradation.confidentQ2PQH8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016529 [CC]sarcoplasmic reticulumprobableGO:0005737, GO:0005783, GO:0043229, GO:0044464, GO:0016528, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0051384 [BP]response to glucocorticoid stimulusprobableGO:0009719, GO:0033993, GO:0031960, GO:0050896, GO:0008150, GO:0048545, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0030246 [MF]carbohydrate bindingprobableGO:0003674, GO:0005488
GO:0007584 [BP]response to nutrientprobableGO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0008150, GO:0042221

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DHU, chain A
Confidence level:confident
Coverage over the Query: 2-83
View the alignment between query and template
View the model in PyMOL