Psyllid ID: psy1336

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MVFIIDSRLELGGSNSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTANETYLSLNMLSLCDIVLNHTANETFDLIV
cEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccEEEEEEEEccccccccccccccccHHHHHHHHHHccccccc
cEEEEEcccccccccccccHHHHcccccccccccccccHHHHHHHHHHHHHHcccEEEEEEEEEccccccHHHcccccHHHHHEHccccccccEcc
MVFIIDsrlelggsnscyslssqldlnplfstpehklswDDVIAFTEKMRTEWQMLSLCDIVLNHTANETYLSLNMLSLCDIVLNhtanetfdliv
mvfiidsrlelggsnSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTANETYLSLNMLSLCDIVLNHTANETFDLIV
MVFIIDSRLELGGSNSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTANETYLSLNMLSLCDIVLNHTANETFDLIV
**FIIDSRLELGGSNSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTANETYLSLNMLSLCDIVLNHTANETFDL**
MVFIIDSRLELGGSNSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTANETYLSLNMLSLCDIVLNHTANETFDLIV
MVFIIDSRLELGGSNSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTANETYLSLNMLSLCDIVLNHTANETFDLIV
MVFIIDSRLEL*GSNSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTANETYLSLNMLSLCDIVLNHTANETFDLIV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFIIDSRLELGGSNSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTANETYLSLNMLSLCDIVLNHTANETFDLIV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query96 2.2.26 [Sep-21-2011]
Q2PQH8 1533 Glycogen debranching enzy yes N/A 0.593 0.037 0.561 2e-13
P35573 1532 Glycogen debranching enzy yes N/A 0.593 0.037 0.526 7e-13
P35574 1555 Glycogen debranching enzy yes N/A 0.593 0.036 0.543 9e-13
A8BQB4 1533 Glycogen debranching enzy yes N/A 0.593 0.037 0.526 1e-11
Q06625 1536 Glycogen debranching enzy yes N/A 0.583 0.036 0.442 0.0003
>sp|Q2PQH8|GDE_CANFA Glycogen debranching enzyme OS=Canis familiaris GN=AGL PE=2 SV=1 Back     alignment and function desciption
 Score = 74.3 bits (181), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 40/57 (70%)

Query: 11  LGGSNSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTA 67
           LG S SCYSL++QL+LNP FS P  K +W DV    EKM+ EW +L + D+V NHTA
Sbjct: 166 LGLSRSCYSLANQLELNPDFSRPNKKYTWSDVGQLVEKMKKEWNVLCITDVVYNHTA 222
Multifunctional enzyme acting as 1,4-alpha-D-glucan:1,4-alpha-D-glucan 4-alpha-D-glycosyltransferase and amylo-1,6-glucosidase in glycogen degradation.
Canis familiaris (taxid: 9615)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 3EC: 3
>sp|P35573|GDE_HUMAN Glycogen debranching enzyme OS=Homo sapiens GN=AGL PE=1 SV=3 Back     alignment and function description
>sp|P35574|GDE_RABIT Glycogen debranching enzyme OS=Oryctolagus cuniculus GN=AGL PE=1 SV=1 Back     alignment and function description
>sp|A8BQB4|GDE_HORSE Glycogen debranching enzyme OS=Equus caballus GN=AGL PE=2 SV=1 Back     alignment and function description
>sp|Q06625|GDE_YEAST Glycogen debranching enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDB1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
327270705 1532 PREDICTED: glycogen debranching enzyme-l 0.635 0.039 0.524 9e-13
118404736 584 amylo-alpha-1, 6-glucosidase, 4-alpha-gl 0.593 0.097 0.614 1e-12
350416729 1979 PREDICTED: glycogen debranching enzyme-l 0.781 0.037 0.505 1e-12
307183953 1498 Glycogen debranching enzyme [Camponotus 0.635 0.040 0.557 1e-12
270013681 1844 hypothetical protein TcasGA2_TC012309 [T 0.635 0.033 0.564 2e-12
380029505 2017 PREDICTED: LOW QUALITY PROTEIN: glycogen 0.635 0.030 0.590 2e-12
189240705 1766 PREDICTED: similar to glycogen debranchi 0.635 0.034 0.564 2e-12
432911764 1536 PREDICTED: glycogen debranching enzyme-l 0.593 0.037 0.596 2e-12
170055188 784 glycogen debranching enzyme [Culex quinq 0.635 0.077 0.564 3e-12
345327736 454 PREDICTED: glycogen debranching enzyme-l 0.593 0.125 0.596 3e-12
>gi|327270705|ref|XP_003220129.1| PREDICTED: glycogen debranching enzyme-like [Anolis carolinensis] Back     alignment and taxonomy information
 Score = 77.4 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 44/61 (72%)

Query: 10  ELGGSNSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTANE 69
           +LG S SCYSL+ QL++NP FSTP  K SW+++    EKM+ EW ML + D+V NHTA+ 
Sbjct: 165 KLGLSRSCYSLADQLEVNPDFSTPNRKCSWNEIGKMVEKMKNEWNMLCITDVVYNHTASN 224

Query: 70  T 70
           +
Sbjct: 225 S 225

Source: Anolis carolinensis

Species: Anolis carolinensis

Genus: Anolis

Family: Iguanidae

Order: Squamata

Class:

Phylum: Chordata

Superkingdom: Eukaryota
>gi|118404736|ref|NP_001072609.1| amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase [Xenopus (Silurana) tropicalis] gi|114107719|gb|AAI22991.1| amylo-1, 6-glucosidase, 4-alpha-glucanotransferase [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|350416729|ref|XP_003491075.1| PREDICTED: glycogen debranching enzyme-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307183953|gb|EFN70541.1| Glycogen debranching enzyme [Camponotus floridanus] Back     alignment and taxonomy information
>gi|270013681|gb|EFA10129.1| hypothetical protein TcasGA2_TC012309 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380029505|ref|XP_003698410.1| PREDICTED: LOW QUALITY PROTEIN: glycogen debranching enzyme-like [Apis florea] Back     alignment and taxonomy information
>gi|189240705|ref|XP_973710.2| PREDICTED: similar to glycogen debranching enzyme [Tribolium castaneum] Back     alignment and taxonomy information
>gi|432911764|ref|XP_004078711.1| PREDICTED: glycogen debranching enzyme-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|170055188|ref|XP_001863470.1| glycogen debranching enzyme [Culex quinquefasciatus] gi|167875214|gb|EDS38597.1| glycogen debranching enzyme [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|345327736|ref|XP_001512439.2| PREDICTED: glycogen debranching enzyme-like [Ornithorhynchus anatinus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
UNIPROTKB|F1NX83 1532 AGL "Uncharacterized protein" 0.687 0.043 0.492 5e-12
UNIPROTKB|F1S557 1318 AGL "Uncharacterized protein" 0.645 0.047 0.539 1.1e-11
UNIPROTKB|F1PBL3 1533 AGL "Glycogen debranching enzy 0.760 0.047 0.472 1.3e-11
UNIPROTKB|Q2PQH8 1533 AGL "Glycogen debranching enzy 0.760 0.047 0.472 1.3e-11
RGD|1306376 1532 Agl "amylo-alpha-1, 6-glucosid 0.593 0.037 0.543 1.7e-11
UNIPROTKB|F1MHT1 1532 AGL "Uncharacterized protein" 0.760 0.047 0.472 2.2e-11
FB|FBgn0034618 1629 CG9485 [Drosophila melanogaste 0.635 0.037 0.548 2.8e-11
UNIPROTKB|P35573 1532 AGL "Glycogen debranching enzy 0.593 0.037 0.526 3.6e-11
UNIPROTKB|P35574 1555 AGL "Glycogen debranching enzy 0.593 0.036 0.543 4.6e-11
ZFIN|ZDB-GENE-071004-6 1539 agla "amylo-1, 6-glucosidase, 0.625 0.038 0.483 8.6e-10
UNIPROTKB|F1NX83 AGL "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 177 (67.4 bits), Expect = 5.0e-12, P = 5.0e-12
 Identities = 33/67 (49%), Positives = 47/67 (70%)

Query:    10 ELGGSNSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTA-N 68
             +LG S SCYSL+ QL++NP FS+   K +W+D+ A  EKM+ EW ML + D+V NHTA N
Sbjct:   166 KLGLSRSCYSLADQLEVNPEFSSHNKKCTWNDIGALVEKMKNEWNMLCITDVVYNHTAAN 225

Query:    69 ETYLSLN 75
               +L ++
Sbjct:   226 SEWLRMH 232
GO:0004134 "4-alpha-glucanotransferase activity" evidence=IEA
GO:0004135 "amylo-alpha-1,6-glucosidase activity" evidence=IEA
GO:0005978 "glycogen biosynthetic process" evidence=IEA
GO:0043169 "cation binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0016234 "inclusion body" evidence=IEA
GO:0030247 "polysaccharide binding" evidence=IEA
GO:0031593 "polyubiquitin binding" evidence=IEA
UNIPROTKB|F1S557 AGL "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PBL3 AGL "Glycogen debranching enzyme" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q2PQH8 AGL "Glycogen debranching enzyme" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1306376 Agl "amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MHT1 AGL "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0034618 CG9485 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P35573 AGL "Glycogen debranching enzyme" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P35574 AGL "Glycogen debranching enzyme" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-6 agla "amylo-1, 6-glucosidase, 4-alpha-glucanotransferase a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P35573GDE_HUMAN3, ., 2, ., 1, ., 3, 30.52630.59370.0372yesN/A
A8BQB4GDE_HORSE3, ., 2, ., 1, ., 3, 30.52630.59370.0371yesN/A
P35574GDE_RABIT3, ., 2, ., 1, ., 3, 30.54380.59370.0366yesN/A
Q2PQH8GDE_CANFA3, ., 2, ., 1, ., 3, 30.56140.59370.0371yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
cd11327 478 cd11327, AmyAc_Glg_debranch_2, Alpha amylase catal 1e-24
TIGR01531 1464 TIGR01531, glyc_debranch, glycogen debranching enz 6e-19
>gnl|CDD|200466 cd11327, AmyAc_Glg_debranch_2, Alpha amylase catalytic domain found in glycogen debranching enzymes Back     alignment and domain information 
 Score = 95.0 bits (237), Expect = 1e-24
 Identities = 30/61 (49%), Positives = 42/61 (68%)

Query: 10  ELGGSNSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTANE 69
           ELG SNS YS++ QL+LNP F     K +++DV    +K+  EW +LS+ D+VLNHTAN 
Sbjct: 60  ELGESNSPYSIADQLELNPDFFPDGKKKTFEDVEELVKKLEKEWGLLSITDVVLNHTANN 119

Query: 70  T 70
           +
Sbjct: 120 S 120

Debranching enzymes facilitate the breakdown of glycogen through glucosyltransferase and glucosidase activity. These activities are performed by a single enzyme in mammals, yeast, and some bacteria, but by two distinct enzymes in Escherichia coli and other bacteria. Debranching enzymes perform two activities, 4-alpha-D-glucanotransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). 4-alpha-D-glucanotransferase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. Amylo-alpha-1,6-glucosidase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. The catalytic triad (DED), which is highly conserved in other debranching enzymes, is not present in this group. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase. Length = 478
>gnl|CDD|233451 TIGR01531, glyc_debranch, glycogen debranching enzymye Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
4aie_A 549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 99.88
1lwj_A 441 4-alpha-glucanotransferase; alpha-amylase family, 99.85
1zja_A 557 Trehalulose synthase; sucrose isomerase, alpha-amy 99.84
1wza_A 488 Alpha-amylase A; hydrolase, halophilic, thermophil 99.84
3dhu_A 449 Alpha-amylase; structural genomics, hydrolase, gly 99.84
2zic_A 543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 99.84
1uok_A 558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 99.83
1m53_A 570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 99.83
2wc7_A 488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 99.83
3aj7_A 589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 99.83
2ze0_A 555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 99.83
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 99.82
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 99.82
4aef_A 645 Neopullulanase (alpha-amylase II); hydrolase, ther 99.81
2z1k_A 475 (NEO)pullulanase; hydrolase, structural genomics, 99.81
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 99.81
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 99.8
1wzl_A 585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 99.78
1ea9_C 583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 99.78
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 99.77
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 99.77
2dh2_A 424 4F2 cell-surface antigen heavy chain; TIM-barrel, 99.77
3zss_A 695 Putative glucanohydrolase PEP1A; alpha-glucan bios 99.77
1j0h_A 588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 99.77
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 99.76
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 99.75
1r7a_A 504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 99.74
1ht6_A 405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 99.74
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 99.74
2bhu_A 602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 99.74
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 99.74
1ji1_A 637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 99.73
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 99.73
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 99.72
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 99.72
1ua7_A 422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 99.72
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 99.72
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 99.71
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 99.71
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 99.71
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 99.71
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 99.7
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 99.7
1mxg_A 435 Alpha amylase; hyperthermostable, family 13 glycos 99.69
2e8y_A 718 AMYX protein, pullulanase; multiple domain, beta-a 99.68
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 99.68
4gqr_A 496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 99.68
1jae_A 471 Alpha-amylase; glycosidase, carbohydrate metabolis 99.67
1g94_A 448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 99.67
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 99.66
3hje_A 704 704AA long hypothetical glycosyltransferase; treha 99.64
2wsk_A 657 Glycogen debranching enzyme; carbohydrate metaboli 99.63
4aio_A 884 Limit dextrinase; hydrolase, pullulanase, glycosid 99.63
1bf2_A 750 Isoamylase; hydrolase, glycosidase, debranching en 99.61
1m7x_A 617 1,4-alpha-glucan branching enzyme; alpha/beta barr 99.6
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 99.6
2wan_A 921 Pullulanase; hydrolase, glycoside hydrolase, polys 99.6
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 99.6
2vr5_A 718 Glycogen operon protein GLGX; hydrolase, glycosida 99.58
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 99.58
3ttq_A 1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 99.57
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 99.55
2fhf_A 1083 Pullulanase; multiple domain, beta-alpha-barrel, a 99.53
3klk_A 1039 Glucansucrase; native form, open conformation, mul 99.52
2ya1_A 1014 Putative alkaline amylopullulanase; hydrolase, gly 99.52
3k1d_A 722 1,4-alpha-glucan-branching enzyme; mycobacterium t 99.48
3mi6_A 745 Alpha-galactosidase; NESG, structural genomics, PS 96.05
2xn2_A 732 Alpha-galactosidase; hydrolase, glycosidase; HET: 96.01
2yfo_A 720 Alpha-galactosidase-sucrose kinase agask; hydrolas 95.87
4fnq_A 729 Alpha-galactosidase AGAB; glycoside hydrolase, hyd 91.88
1zy9_A 564 Alpha-galactosidase; TM1192, struc genomics, joint 89.78
1now_A 507 Beta-hexosaminidase beta chain; (beta/alpha)8-barr 87.88
1qnr_A 344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 86.68
1jak_A 512 Beta-N-acetylhexosaminidase; glycoside hydrolase, 85.71
1ceo_A 343 Cellulase CELC; glycosyl hydrolase, family A/5 of 84.76
2gjx_A 507 Beta-hexosaminidase alpha chain; beta-hexosaminida 83.51
3n9k_A 399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 81.99
1ur4_A 399 Galactanase; hydrolase, beta-1, glycoside hydrolas 81.44
1g01_A 364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 81.37
3vup_A 351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 80.2
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
Probab=99.88  E-value=3.2e-23  Score=163.25  Aligned_cols=71  Identities=15%  Similarity=0.284  Sum_probs=67.4

Q ss_pred             eEeecCCccCCCCCCccccCcccccCCCCCCCCCCCcHHHHHHHHHHHHhhcCceEEeeeeccccCCCchhHHhcccc
Q psy1336           2 VFIIDSRLELGGSNSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTANETYLSLNMLSL   79 (96)
Q Consensus         2 ~IhltPi~~~G~s~S~YsI~D~~~i~p~~g~~~~~~t~~dl~~lv~~~~~~~Gi~~ilD~V~NHTA~ds~Wl~ehPe~   79 (96)
                      .|||+||++.+.++.+|+++||++|||+||      |++||++||+++|+ +||+||+|+|+||||.+|+|+++++..
T Consensus        48 ~I~L~Pi~~~~~~~~GYd~~dy~~vdp~~G------t~~dfk~Lv~~aH~-~Gi~VilD~V~NHts~~~~wf~~~~~~  118 (549)
T 4aie_A           48 AIWLSPVYQSPGVDNGYDISDYEAIDPQYG------TMADMDELISKAKE-HHIKIVMDLVVNHTSDQHKWFVEAKKG  118 (549)
T ss_dssp             EEEECCCEECCCTTTTSSCSEEEEECTTTC------CHHHHHHHHHHHHH-TTCEEEEEECCSBCCTTSHHHHHHTTC
T ss_pred             EEEeCCCcCCCCCCCCcCccCCCCcCcccC------CHHHHHHHHHHHHH-CCCEEEEEECccCCcCCcchhhhhhhc
Confidence            699999999998899999999999999999      89999999999997 799999999999999999999987643
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} Back     alignment and structure
>2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* Back     alignment and structure
>2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* Back     alignment and structure
>4fnq_A Alpha-galactosidase AGAB; glycoside hydrolase, hydrolase; 1.80A {Geobacillus stearothermophilus} PDB: 4fnr_A 4fnu_A* 4fnt_A* 4fns_A* 4fnp_A* Back     alignment and structure
>1zy9_A Alpha-galactosidase; TM1192, struc genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13 Back     alignment and structure
>1now_A Beta-hexosaminidase beta chain; (beta/alpha)8-barrel, homodimer, family 20 glycosidase, HYDR; HET: NAG IFG; 2.20A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 1nou_A* 1np0_A* 2gjx_B* 3lmy_A* 1o7a_A* 2gk1_B* Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>1jak_A Beta-N-acetylhexosaminidase; glycoside hydrolase, family 20, substrate-assisted catalysis, alpha/beta barrel, isofagomin inhibitor complex; HET: IFG; 1.75A {Streptomyces plicatus} SCOP: c.1.8.6 d.92.2.1 PDB: 1hp4_A* 1hp5_A* 1m01_A* 1m04_A* 1m03_A* Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>2gjx_A Beta-hexosaminidase alpha chain; beta-hexosaminidase A, glycosidase, TAY-sachs disease, GM2 ganglisode, TIM barrel, hydrolase; HET: NAG BMA NDG; 2.80A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 2gk1_A* Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
d1eh9a3 400 Glycosyltrehalose trehalohydrolase, central domain 99.87
d1m7xa3 396 1,4-alpha-glucan branching enzyme, central domain 99.87
d1gjwa2 572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 99.86
d1h3ga3 422 Cyclomaltodextrinase, central domain {Flavobacteri 99.85
d1uoka2 479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 99.85
d1m53a2 478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 99.84
d1g5aa2 554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 99.84
d1ht6a2 347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 99.83
d1bf2a3 475 Isoamylase, central domain {Pseudomonas amyloderam 99.83
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 99.83
d1r7aa2 434 Sucrose phosphorylase {Bifidobacterium adolescenti 99.83
d2bhua3 420 Glycosyltrehalose trehalohydrolase, central domain 99.82
d1ji1a3 432 Maltogenic amylase, central domain {Thermoactinomy 99.82
d1wzaa2 409 Bacterial alpha-amylase {Halothermothrix orenii [T 99.82
d2guya2 381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 99.81
d1j0ha3 382 Neopullulanase, central domain {Bacillus stearothe 99.8
d1gcya2 357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 99.8
d3bmva4 406 Cyclodextrin glycosyltransferase {Thermoanaerobact 99.8
d1ea9c3 382 Maltogenic amylase, central domain {Bacillus sp., 99.79
d1ua7a2 344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 99.79
d1lwha2 391 4-alpha-glucanotransferase {Thermotoga maritima [T 99.78
d1wzla3 382 Maltogenic amylase, central domain {Thermoactinomy 99.78
d1mxga2 361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 99.77
d1qhoa4 407 Cyclodextrin glycosyltransferase {Bacillus stearot 99.77
d1g94a2 354 Bacterial alpha-amylase {Pseudoalteromonas halopla 99.77
d1ud2a2 390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 99.77
d2aaaa2 381 Fungal alpha-amylases {Aspergillus niger, acid amy 99.76
d1hx0a2 403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 99.74
d1jaea2 378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 99.73
d1hvxa2 393 Bacterial alpha-amylase {Bacillus stearothermophil 99.72
d2d3na2 394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 99.71
d1e43a2 393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 99.7
d1iv8a2 653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 99.7
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 96.97
d1zy9a2 348 Alpha-galactosidase GalA catalytic domain {Thermot 95.16
d1qbaa3 443 Bacterial chitobiase (beta-N-acetylhexosaminidase) 90.33
d1hjsa_ 332 Beta-1,4-galactanase {Thielavia heterothallica, ak 89.38
d1ceoa_ 340 Endoglucanase CelC {Clostridium thermocellum [TaxI 88.2
d1g01a_ 357 Alkaline cellulase K catalytic domain {Bacillus sp 87.9
d1wkya2 297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 87.89
d1foba_ 334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 87.8
d1tvna1 293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 87.48
d1nowa1 353 beta-hexosaminidase B {Human (Homo sapiens) [TaxId 86.97
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 86.68
d2gjxa1 362 beta-hexosaminidase A {Human (Homo sapiens) [TaxId 85.95
d1ecea_ 358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 85.28
d1egza_ 291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 85.25
d1h4pa_ 408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 84.72
d2f2ha4 338 Putative glucosidase YicI, domain 2 {Escherichia c 84.59
d1rh9a1 370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 84.1
d1uuqa_ 410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 83.75
d1vjza_ 325 Endoglucanase homologue TM1752 {Thermotoga maritim 83.73
d1bqca_ 302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 83.71
d2pb1a1 394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 82.81
d2c0ha1 350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 82.4
d7a3ha_ 300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 80.35
d1ur4a_ 387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 80.1
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Glycosyltrehalose trehalohydrolase, central domain
species: Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]

Probab=99.87  E-value=1.4e-22  Score=150.63  Aligned_cols=81  Identities=9%  Similarity=0.039  Sum_probs=72.7

Q ss_pred             eEeecCCccCC-CCCCccccCcccccCCCCCCCCCCCcHHHHHHHHHHHHhhcCceEEeeeeccccCCCchhHHhccccc
Q psy1336           2 VFIIDSRLELG-GSNSCYSLSSQLDLNPLFSTPEHKLSWDDVIAFTEKMRTEWQMLSLCDIVLNHTANETYLSLNMLSLC   80 (96)
Q Consensus         2 ~IhltPi~~~G-~s~S~YsI~D~~~i~p~~g~~~~~~t~~dl~~lv~~~~~~~Gi~~ilD~V~NHTA~ds~Wl~ehPe~~   80 (96)
                      .|||+||++.+ .++-+|+++||++|||.||      |++||++||+++|+ +||+||+|+|+||||.+|+|+.+++.|+
T Consensus        45 ~i~l~Pv~~~~~~~~~GY~~~d~~~vd~~~G------t~~dlk~lv~~~h~-~gi~VilD~V~NH~s~~~~~~~~~~~~~  117 (400)
T d1eh9a3          45 AIEIMPIAQFPGKRDWGYDGVYLYAVQNSYG------GPEGFRKLVDEAHK-KGLGVILDVVYNHVGPEGNYMVKLGPYF  117 (400)
T ss_dssp             EEEECCCBCCSSSCCCSTTCCCTTCBCSTTC------CHHHHHHHHHHHHH-TTCEEEEEECCSCCCSSSCCHHHHSCCS
T ss_pred             EEEeCCcCcCCCCCCCCCCCCCCCCcCcccC------CHHHHHHHHHHHHh-cCCceeeecccccccCCCcchhhhcccc
Confidence            59999999864 4567999999999999999      89999999999997 7999999999999999999999999988


Q ss_pred             hhccCCCcc
Q psy1336          81 DIVLNHTAN   89 (96)
Q Consensus        81 yn~~n~~~~   89 (96)
                      +.-...+..
T Consensus       118 ~~~~~~~~~  126 (400)
T d1eh9a3         118 SQKYKTPWG  126 (400)
T ss_dssp             CSSCCCSSS
T ss_pred             ccccccccc
Confidence            776555543
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qbaa3 c.1.8.6 (A:338-780) Bacterial chitobiase (beta-N-acetylhexosaminidase) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1nowa1 c.1.8.6 (A:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2gjxa1 c.1.8.6 (A:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure