Diaphorina citri psyllid: psy13379

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------83
MREKRGGVVRKGKEEEEKEEEEGPIVRDPDSVIYHPNLNILIVLSRNAECIVVDINSGCVLRKCAFAEEGQPIKGAYLPSYDKVLLTDTKSVGVRSDYNGVLLLDTMLQTCLKSKNNPVKLEMLVSEAILLQQTLKTIETTGCEFSPGLWTEVLTELETKIEAAQSEPKKSAKSQKWNIICLELKHASFKTACYSLVCELKRQNRHVPALAIASAINERLNCLHPTPFPIDSQPSDHRNLMFSEAARRETFAKWPHMDYKWALPDQMAQAGFYHQPSGTGYDRAMCFTILWALPDQMAQAGFYHQLSGTGDDRAMCFTIMGITRSDLAQAVSIISQVIGITDSGTGRFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWAEHERHSPCCPFVKGEYTQNVPLSVTYATAPALAMTHALNPDSTLVDITTLPGYIPLISRDSTVLVLNYIRQLKTLPRCLAISRSYHETVPCWYSTMYDLVWRIARLPSPWSRVQFPPEGGFYPEQIMLDLGTADILLSCPPHAAWLYPAHITRQYRAGTQLYTTTQDITTLSGYILLISRDSTVLVLNYVRQLKVENEFSVSKLCYDYGLSHSELKVSAAAIAANVKHSSKASESLDEEHVNREETENVPRPCLIVGARMKTTGEDLYQLKQRLESGGNPLAMDTELTSSPPPPSPHLCLLVLDFHYRPNKSPATAGTQTSAPGNKKAVSGTGTSTATVGGGKLIQVVKLSASPVKSLTPATPGEGIRKAILLPQDQSSTVLAGLTTSGTLVLMDVLKLEVLSSLLPIEGQEFVTLTYCNNR
cccccccccccccHHHHccccccccccccccEEECccccEEEEEEEccEEEEEEcccccEEEEEccccccccEEEEEEccccEEEEEccccEEECcccccEEEEHHHcccccccccccEEEEEEHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEcccHHHHHHccccHHHHccccccccccHHHHHHHHccccccccccccccccccccccccHHHHHHHcccccccccccccHHHHHHcccEEcccccccccEEEcEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccEEcccccccccEEEEEcccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccHHHHHHHHccccccccccEEcccccccccccccccccccccccccccccccHcEEccccccccccccccccccccccCEECccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHcEEEEEEEEcEEHHHcccccccHHHHHHHHccccccccccccccHHHcccHHcccccccEEEEccccccccHHHHHHHHHHHccccccccccccccccccccccEEEEEEECccccccccccccccccccccccccccccccEEECcccEEEEEEEEcccccccccccccccccccEEcccccccccEEECcccccEEEEEEHHHHHHHHccccccccEEEEEEEEccc
**************************RDPDSVIYHPNLNILIVLSRNAECIVVDINSGCVLRKCAFAEEGQPIKGAYLPSYDKVLLTDTKSVGVRSDYNGVLLLDTMLQTCLKSKNNPVKLEMLVSEAILLQQTLKTIETTGCEFSPGLWTEVLTELET****************KWNIICLELKHASFKTACYSLVCELKRQNRHVPALAIA****E*L*CLHPTPF**************SEAARRETFAKWPHMDYKWALPDQMAQAGFYHQPSGTGYDRAMCFTILWALPDQMAQAGFYHQLSGTGDDRAMCFTIMGITRSDLAQAVSIISQVIGITDSGTGRFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWAEHERHSPCCPFVKGEYTQNVPLSVTYATAPALAMTHA**PDSTLVDITTLPGYIPLISRDSTVLVLNYIRQLKTLPRCLAISRSYHETVPCWYSTMYDLVWRIARLPSPWSRVQFPPEGGFYPEQIMLDLGTADILLSCPPHAAWLYPAHITRQYRAGTQLYTTTQDITTLSGYILLISRDSTVLVLNYVRQLKVENEFSVSKLCYDYGLSHSELKVSAAAIA**************************PRPCLIVGARMKTTGEDLYQLKQR******************PPPSPHLCLLVLDFHYRP*************************STATVGGGKLIQVVKLSASPVKSLTPATPGEGIRKAILLPQDQSSTVLAGLTTSGTLVLMDVLKLEVLSSLLPIEGQEFVTLTYCN**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MREKRGGVVRKGKEEEEKEEEEGPIVRDPDSVIYHPNLNILIVLSRNAECIVVDINSGCVLRKCAFAEEGQPIKGAYLPSYDKVLLTDTKSVGVRSDYNGVLLLDTMLQTCLKSKNNPVKLEMLVSEAILLQQTLKTIETTGCEFSPGLWTEVLTELETKIEAAQSEPKKSAKSQKWNIICLELKHASFKTACYSLVCELKRQNRHVPALAIASAINERLNCLHPTPFPIDSQPSDHRNLMFSEAARRETFAKWPHMDYKWALPDQMAQAGFYHQPSGTGYDRAMCFTILWALPDQMAQAGFYHQLSGTGDDRAMCFTIMGITRSDLAQAVSIISQVIGITDSGTGRFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWAEHERHSPCCPFVKGEYTQNVPLSVTYATAPALAMTHALNPDSTLVDITTLPGYIPLISRDSTVLVLNYIRQLKTLPRCLAISRSYHETVPCWYSTMYDLVWRIARLPSPWSRVQFPPEGGFYPEQIMLDLGTADILLSCPPHAAWLYPAHITRQYRAGTQLYTTTQDITTLSGYILLISRDSTVLVLNYVRQLKVENEFSVSKLCYDYGLSHSELKVSAAAIAANVKHSSKASESLDEEHVNREETENVPRPCLIVGARMKTTGEDLYQLKQRLESGGNPLAMDTELTSSPPPPSPHLCLLVLDFHYRPNKSPATAGTQTSAPGNKKAVSGTGTSTATVGGGKLIQVVKLSASPVKSLTPATPGEGIRKAILLPQDQSSTVLAGLTTSGTLVLMDVLKLEVLSSLLPIEGQEFVTLTYCNNR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044424 [CC]intracellular partprobableGO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SIQ, chain A
Confidence level:very confident
Coverage over the Query: 338-431
View the alignment between query and template
View the model in PyMOL
Template: 3SIQ, chain A
Confidence level:very confident
Coverage over the Query: 238-329
View the alignment between query and template
View the model in PyMOL
Template: 2QFA, chain A
Confidence level:very confident
Coverage over the Query: 382-438,450-487
View the alignment between query and template
View the model in PyMOL
Template: 2QFA, chain A
Confidence level:very confident
Coverage over the Query: 453-520
View the alignment between query and template
View the model in PyMOL
Template: 4GGC, chain A
Confidence level:probable
Coverage over the Query: 31-87
View the alignment between query and template
View the model in PyMOL
Template: 2KNA, chain A
Confidence level:probable
Coverage over the Query: 518-532,554-578
View the alignment between query and template
View the model in PyMOL