Psyllid ID: psy13379

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------83
MREKRGGVVRKGKEEEEKEEEEGPIVRDPDSVIYHPNLNILIVLSRNAECIVVDINSGCVLRKCAFAEEGQPIKGAYLPSYDKVLLTDTKSVGVRSDYNGVLLLDTMLQTCLKSKNNPVKLEMLVSEAILLQQTLKTIETTGCEFSPGLWTEVLTELETKIEAAQSEPKKSAKSQKWNIICLELKHASFKTACYSLVCELKRQNRHVPALAIASAINERLNCLHPTPFPIDSQPSDHRNLMFSEAARRETFAKWPHMDYKWALPDQMAQAGFYHQPSGTGYDRAMCFTILWALPDQMAQAGFYHQLSGTGDDRAMCFTIMGITRSDLAQAVSIISQVIGITDSGTGRFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWAEHERHSPCCPFVKGEYTQNVPLSVTYATAPALAMTHALNPDSTLVDITTLPGYIPLISRDSTVLVLNYIRQLKTLPRCLAISRSYHETVPCWYSTMYDLVWRIARLPSPWSRVQFPPEGGFYPEQIMLDLGTADILLSCPPHAAWLYPAHITRQYRAGTQLYTTTQDITTLSGYILLISRDSTVLVLNYVRQLKVENEFSVSKLCYDYGLSHSELKVSAAAIAANVKHSSKASESLDEEHVNREETENVPRPCLIVGARMKTTGEDLYQLKQRLESGGNPLAMDTELTSSPPPPSPHLCLLVLDFHYRPNKSPATAGTQTSAPGNKKAVSGTGTSTATVGGGKLIQVVKLSASPVKSLTPATPGEGIRKAILLPQDQSSTVLAGLTTSGTLVLMDVLKLEVLSSLLPIEGQEFVTLTYCNNR
ccccccccccccHHHHHccccccccccccccEEEEccccEEEEEEEccEEEEEEcccccEEEEEccccccccEEEEEEccccEEEEEccccEEEEcccccEEEEHHHcccccccccccEEEEEEHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEcccHHHHHHccccHHHHccccccccccHHHHHHHHccccccccccccccccccccccccHHHHHHHcccccccccccccHHHHHHcccEEcccccccccEEEcEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccEEcccccccccEEEEEcccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccHHHHHHHHccccccccccEEccccccccccccccccccccccccccccccHHHEEccccccccccccccccccccccEEEEccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHcEEEEEEEEcEEHHHcccccccHHHHHHHHccccccccccccccHHHHcHHHHccccccEEEEccccccccHHHHHHHHHHHccccccccccccccccccccccEEEEEEEEccccccccccccccccccccccccccccccEEEEcccEEEEEEEEcccccccccccccccccccEEcccccccccEEEEcccccEEEEEEHHHHHHHHccccccccEEEEEEEEccc
cccccccEEEccccHHHccccccccccccccEEEccccEEEEEEEcccEEEEEEcccHHEEEHHHHcccccEEEEEEEccccEEEEEcccEEEEccccccEEEHHHHccccccccccEEEEEEcHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEccccccccccccccccccHHHHHHHHHcccccccccccccHcHcHHHHccccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHcccEEEcccccccEEEEEEcccEEccccccccccEEccccccccccccccccEEccccccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHccEEEEcccccccEEEEEEcccccccccccccHHHHHHHHcccccHEEEcccccccccccccccHHHHHHHcccccccccccccccccccccccccEEEEEcccccccccHHHHHHccccccEEEEEEccccccEEEccccccccHHccccccccccccccHHHHcHHHEHccccccccccccccccEccccccEEEEccccHHHHcEEEEEEEcccEEEEEEHHEEcEEEccEEEEEHcEcccccccHHHHHHHHHHHHccccccccccccHHHccccccccccccEEEEEcEEcccHHHHHHHHHHHHccccccccccccccccccccccEEEEEEEccccccccccccccccccccccEEEccccccEEEccccEEEEEEEEccccccccccccccccHEEEEEcccccccEEEEcccccHHHHHHHHHHHHHHHccccccccEEEEEEEcccc
mrekrggvvrkgkeeeekeeeegpivrdpdsviyhpnlNILIVLSRNAEcivvdinsgcvlrkcafaeegqpikgaylpsydkvlltdtksvgvrsdynGVLLLDTMLQTClksknnpvKLEMLVSEAILLQQTLKTIettgcefspglWTEVLTELETKIEAaqsepkksaksqKWNIICLELKHASFKTACYSLVCELkrqnrhvpALAIASAINERlnclhptpfpidsqpsdhrnlMFSEAARRETfakwphmdykwalpdqmaqagfyhqpsgtgydrAMCFTILWALPDqmaqagfyhqlsgtgddrAMCFTIMGITRSDLAQAVSIISQVigitdsgtgrflssaqwyrdddraiwalpdqmaqagfyhqpsgtgddramCFTCIVClvcweptdepwaeherhspccpfvkgeytqnvplsvTYATAPAlamthalnpdstlvdittlpgyiplisrdSTVLVLNYIRQLKTLPRCLAISrsyhetvpcwYSTMYDLVWRIarlpspwsrvqfppeggfypeqiMLDLgtadillscpphaawlypahitrqyragtqlytttqdiTTLSGYILLISRDSTVLVLNYVRQLKVENEFSVSKLCYDYGLSHSELKVSAAAIAANVKhsskasesldeehvnreetenvprpclivgarmkttGEDLYQLKQRLesggnplamdteltssppppsphlcllvldfhyrpnkspatagtqtsapgnkkavsgtgtstatvggGKLIQVVKlsaspvksltpatpgegirkaillpqdqsstvlaglttsgtLVLMDVLKLEVlssllpiegqefVTLTYCNNR
mrekrggvvrkgkeeeekeeeegpivrdpdsviyHPNLNILIVLSRNAECIVVDINSGCVLRKCAFAeegqpikgaylpsyDKVLLTDTKSVGVRSDYNGVLLLDTMLQTCLKSKNNPVKLEMLVSEAILLQQTLKTIETTGCEFSPGLWTEVLTELETKIEaaqsepkksaksqKWNIICLELKHASFKTACYSLVCELKRQNRHVPALAIASAINERLNCLHPTPFPIDSQPSDHRNLMFSEAARRETFAKWPHMDYKWALPDQMAQAGFYHQPSGTGYDRAMCFTILWALPDQMAQAGFYHQLSGTGDDRAMCFTIMGITRSDLAQAVSIISQvigitdsgtgrFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWAEHERHSPCCPFVKGEYTQNVPLSVTYATAPALAMTHALNPDSTLVDITTLPGYIPLISRDSTVLVLNYIRQLKTLPRCLAISRSYHETVPCWYSTMYDLVWRIARLPSPWSRVQFPPEGGFYPEQIMLDLGTADILLSCPPHAAWLYPAHITRQYRAGTQLYTTTQDITTLSGYILLISRDSTVLVLNYVRQLKVENEFSVSKLCYDYGLSHSELKVSAAAIAANVKHsskasesldeehvnreetenvprpclivgARMKTTGEDLYQLKQRLESGGNPLAMDTELTSSPPPPSPHLCLLVLDFHYRPNKSpatagtqtsapgnkkavsgtgtstatvggGKLIQVVKlsaspvksltpatpgegIRKAILLPQDQSSTVLAGLTTSGTLVLMDVLKLEVLssllpiegqefvtltycnnr
MrekrggvvrkgkeeeekeeeegPIVRDPDSVIYHPNLNILIVLSRNAECIVVDINSGCVLRKCAFAEEGQPIKGAYLPSYDKVLLTDTKSVGVRSDYNGVLLLDTMLQTCLKSKNNPVKLEMLVSEAILLQQTLKTIETTGCEFSPGLWTEVLTELETKIEAAQSEPKKSAKSQKWNIICLELKHASFKTACYSLVCELKRQNRHVPALAIASAINERLNCLHPTPFPIDSQPSDHRNLMFSEAARRETFAKWPHMDYKWALPDQMAQAGFYHQPSGTGYDRAMCFTILWALPDQMAQAGFYHQLSGTGDDRAMCFTIMGITRSDLAQAVSIISQVIGITDSGTGRFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWAEHERHSPCCPFVKGEYTQNVPLSVTYATAPALAMTHALNPDSTLVDITTLPGYIPLISRDSTVLVLNYIRQLKTLPRCLAISRSYHETVPCWYSTMYDLVWRIARLPSPWSRVQFPPEGGFYPEQIMLDLGTADILLSCPPHAAWLYPAHITRQYRAGtqlytttqdittlSGYILLISRDSTVLVLNYVRQLKVENEFSVSKLCYDYGLSHSELKVSAAAIAANVKHSSKASESLDEEHVNREETENVPRPCLIVGARMKTTGEDLYQLKQRLESGGNPLAMDTELTssppppspHLCLLVLDFHYRPNKSPATAGTQTSAPGNKKavsgtgtstatvgggKLIQVVKLSASPVKSLTPATPGEGIRKAILLPQDQSSTVLAGLTTSGTLVLMDVLKLEVLSSLLPIEGQEFVTLTYCNNR
******************************SVIYHPNLNILIVLSRNAECIVVDINSGCVLRKCAFAEEGQPIKGAYLPSYDKVLLTDTKSVGVRSDYNGVLLLDTMLQTCLKSKNNPVKLEMLVSEAILLQQTLKTIETTGCEFSPGLWTEVLTELET****************KWNIICLELKHASFKTACYSLVCELKRQNRHVPALAIASAINERLNCLHPTPF****************AARRETFAKWPHMDYKWALPDQMAQAGFYHQPSGTGYDRAMCFTILWALPDQMAQAGFYHQLSGTGDDRAMCFTIMGITRSDLAQAVSIISQVIGITDSGTGRFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWAEHERHSPCCPFVKGEYTQNVPLSVTYATAPALAMTHALNPDSTLVDITTLPGYIPLISRDSTVLVLNYIRQLKTLPRCLAISRSYHETVPCWYSTMYDLVWRIARLPSPWSRVQFPPEGGFYPEQIMLDLGTADILLSCPPHAAWLYPAHITRQYRAGTQLYTTTQDITTLSGYILLISRDSTVLVLNYVRQLKVENEFSVSKLCYDYGLSHSELKVSAAAIA*****************************CLIVGARMK***********************************HLCLLVLDFHY********************************GGGKLIQVVKL****************IRKAILLPQDQSSTVLAGLTTSGTLVLMDVLKLEVLSSLLPIEGQEFVTLTYC***
**************************RDPDSVIYHPNLNILIVLSRNAECIVVDINSGCVLR*************AYLPSYDKVLLTDTKSVGVRSDYNGVLLLDTMLQTCLKSKNNPVKLEMLVSEAILLQQTLKTIETTGCEFSPGLWTEVLTELE******************WNIICLELKHASFK****************************************************SEAARRETFAKWPHMDYKWALPDQMAQAGFYHQPSGTGYDRAMCFTILWALPDQMAQAGFYHQLSGTGDDRAMCFTIMGITRSDLAQAVSIISQVIGITDSGTGRFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWAEHERHSPCCPFVKGEYT********************************************************TLPRCLAISRSYHETVPCWYSTMYDLVWRIARLPSPWSRVQFPPEGGFYPEQIMLD****************************************TLSGYILLISRDSTVLVLNYVRQLKVENEFSVSKLCYDYGLSHSE***********************************PRPCLIVGARMKTTGEDLYQLKQR******************PPPSPHLCLLVLDFHYRP*************************STATVGGGKLIQVVKLSASPVKSLTPATPGEGIRKAILLPQDQSSTVLAGLTTSGTLVLMDVLKLEVLSSLLPIEGQEFVTLTYCN**
************************IVRDPDSVIYHPNLNILIVLSRNAECIVVDINSGCVLRKCAFAEEGQPIKGAYLPSYDKVLLTDTKSVGVRSDYNGVLLLDTMLQTCLKSKNNPVKLEMLVSEAILLQQTLKTIETTGCEFSPGLWTEVLTELETKIE*************KWNIICLELKHASFKTACYSLVCELKRQNRHVPALAIASAINERLNCLHPTPFPIDSQPSDHRNLMFSEAARRETFAKWPHMDYKWALPDQMAQAGFYHQPSGTGYDRAMCFTILWALPDQMAQAGFYHQLSGTGDDRAMCFTIMGITRSDLAQAVSIISQVIGITDSGTGRFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDE********SPCCPFVKGEYTQNVPLSVTYATAPALAMTHALNPDSTLVDITTLPGYIPLISRDSTVLVLNYIRQLKTLPRCLAISRSYHETVPCWYSTMYDLVWRIARLPSPWSRVQFPPEGGFYPEQIMLDLGTADILLSCPPHAAWLYPAHITRQYRAGTQLYTTTQDITTLSGYILLISRDSTVLVLNYVRQLKVENEFSVSKLCYDYGLSHSELKVSAAAIA*************************VPRPCLIVGARMKTTGEDLYQLKQRLESGGNPLAMD*********PSPHLCLLVLDFHYRPNKS************************ATVGGGKLIQVVKLSASPVKSLTPATPGEGIRKAILLPQDQSSTVLAGLTTSGTLVLMDVLKLEVLSSLLPIEGQEFVTLTYCNNR
**********************GPIVRDPDSVIYHPNLNILIVLSRNAECIVVDINSGCVLRKCAFAEEGQPIKGAYLPSYDKVLLTDTKSVGVRSDYNGVLLLDTMLQTCLKSKNNPVKLEMLVSEAILLQQTLKTIETTGCEFSPGLWTEVLTELETKIEAAQSEPKKSAKSQKWNIICLELKHASFKTACYSLVCELKRQNRHVPALAIA****E*L*CLHPTPFPIDSQPSDHRNLMFSEAARRETFAKWPHMDYKWALPDQMAQAGFYHQPSGTGYDRAMCFTILWALPDQMAQAGFYHQLSGTGDDRAMCFTIMGITRSDLAQAVSIISQVIGITDSGTGRFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWAEHERHSPCCPFVKGEYTQNVPLSVTYATAPALAMTHA**PDSTLVDITTLPGYIPLISRDSTVLVLNYIRQLKTLPRCLAISRSYHETVPCWYSTMYDLVWRIARLPSPWSRVQFPPEGGFYPEQIMLDLGTADILLSCPPHAAWLYPAHITRQYRAGTQLYTTTQDITTLSGYILLISRDSTVLVLNYVRQLKVENEFSVSKLCYDYGLSHSELKVSAAAIA************************NVPRPCLIVGARMKTTGEDLYQLKQRLE****P******LTSSPPPPSPHLCLLVLDFHYRPNK***************K*V**TGTSTATVGGGKLIQVVKLSASPVKSLTP*TPGEGIRKAILLPQDQSSTVLAGLTTSGTLVLMDVLKLEVLSSLLPIEGQEFVTLTYCNNR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MREKRGGVVRKGKEEEEKEEEEGPIVRDPDSVIYHPNLNILIVLSRNAECIVVDINSGCVLRKCAFAEEGQPIKGAYLPSYDKVLLTDTKSVGVRSDYNGVLLLDTMLQTCLKSKNNPVKLEMLVSEAILLQQTLKTIETTGCEFSPGLWTEVLTELETKIEAAQSEPKKSAKSQKWNIICLELKHASFKTACYSLVCELKRQNRHVPALAIASAINERLNCLHPTPFPIDSQPSDHRNLMFSEAARRETFAKWPHMDYKWALPDQMAQAGFYHQPSGTGYDRAMCFTILWALPDQMAQAGFYHQLSGTGDDRAMCFTIMGITRSDLAQAVSIISQVIGITDSGTGRFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWAEHERHSPCCPFVKGEYTQNVPLSVTYATAPALAMTHALNPDSTLVDITTLPGYIPLISRDSTVLVLNYIRQLKTLPRCLAISRSYHETVPCWYSTMYDLVWRIARLPSPWSRVQFPPEGGFYPEQIMLDLGTADILLSCPPHAAWLYPAHITRQYRAGTQLYTTTQDITTLSGYILLISRDSTVLVLNYVRQLKVENEFSVSKLCYDYGLSHSELKVSAAAIAANVKHSSKASESLDEEHVNREETENVPRPCLIVGARMKTTGEDLYQLKQRLESGGNPLAMDTELTSSPPPPSPHLCLLVLDFHYRPNKSPATAGTQTSAPGNKKAVSGTGTSTATVGGGKLIQVVKLSASPVKSLTPATPGEGIRKAILLPQDQSSTVLAGLTTSGTLVLMDVLKLEVLSSLLPIEGQEFVTLTYCNNR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query828 2.2.26 [Sep-21-2011]
Q9NR09 4857 Baculoviral IAP repeat-co yes N/A 0.306 0.052 0.403 3e-48
O88738 4882 Baculoviral IAP repeat-co yes N/A 0.306 0.052 0.403 5e-48
P98170497 E3 ubiquitin-protein liga no N/A 0.231 0.386 0.280 3e-09
Q13489604 Baculoviral IAP repeat-co no N/A 0.194 0.266 0.287 4e-09
A5D8Q0488 E3 ubiquitin-protein liga N/A N/A 0.196 0.334 0.282 8e-09
Q804H7157 Baculoviral IAP repeat-co N/A N/A 0.084 0.445 0.388 2e-08
Q50L39157 Baculoviral IAP repeat-co N/A N/A 0.084 0.445 0.388 2e-08
Q28H51160 Baculoviral IAP repeat-co no N/A 0.062 0.325 0.471 2e-08
Q9R0I6496 E3 ubiquitin-protein liga no N/A 0.266 0.445 0.261 2e-08
Q28ER3156 Baculoviral IAP repeat-co no N/A 0.084 0.448 0.416 2e-08
>sp|Q9NR09|BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens GN=BIRC6 PE=1 SV=2 Back     alignment and function desciption
 Score =  194 bits (493), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 106/263 (40%), Positives = 158/263 (60%), Gaps = 9/263 (3%)

Query: 31  SVIYHPNLNILIVLSRNAECIVVDINSGCVLRKCAF-AEEGQPIKGAYLPSYDKVLLTDT 89
           S+ YHP LN ++ ++      V+D  SG  L+  A  A+ G  +K  Y+ + DKV+  D 
Sbjct: 72  SLSYHPALNAILAVTSRGTIKVIDGTSGATLQASALSAKPGGQVKCQYISAVDKVIFVDD 131

Query: 90  KSVGVRSDYNGVLLLDTMLQTCLKSKNNPVKLEMLVSEAI-LLQQTLKTIETTGCEFSPG 148
            +VG R D NG+LLLDT LQT +  +++ V+LE+ V+EA  LL   L+ ++ +  E    
Sbjct: 132 YAVGCRKDLNGILLLDTALQTPVSKQDDVVQLELPVTEAQQLLSACLEKVDISSTEG--- 188

Query: 149 LWTEVLTELETKIEAAQSEPKKSAKSQKWNIICLELKHASFKTACYSLVCELKRQNRHVP 208
            +   +T+L+  ++    E   + K  KW  +   L H   K+   ++V ELK+ N++V 
Sbjct: 189 -YDLFITQLKDGLKNTSHETAANHKVAKWATVTFHLPHHVLKSIASAIVNELKKINQNVA 247

Query: 209 ALAIASAINERLNCLHPTPFP---IDSQPSDHRNLMFSEAARRETFAKWPHMDYKWALPD 265
           AL +AS++ +RL+ L P+  P   +    S  R+LM+SEA RRETF  WPH+ Y+WA PD
Sbjct: 248 ALPVASSVMDRLSYLLPSARPELGVGPGRSVDRSLMYSEANRRETFTSWPHVGYRWAQPD 307

Query: 266 QMAQAGFYHQPSGTGYDRAMCFT 288
            MAQAGFYHQP+ +G DRAMCFT
Sbjct: 308 PMAQAGFYHQPASSGDDRAMCFT 330
Anti-apoptotic protein which can regulate cell death by controlling caspases and by acting as an E3 ubiquitin-protein ligase. Has an unusual ubiquitin conjugation system in that it could combine in a single polypeptide, ubiquitin conjugating (E2) with ubiquitin ligase (E3) activity, forming a chimeric E2/E3 ubiquitin ligase. Its tragets include CASP9 and DIABLO/SMAC. Acts as an inhibitor of CASP3, CASP7 and CASP9. Important regulator for the final stages of cytokinesis. Crucial for normal vesicle targeting to the site of abscission, but also for the integrity of the midbody and the midbody ring, and its striking ubiquitin modification.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|O88738|BIRC6_MOUSE Baculoviral IAP repeat-containing protein 6 OS=Mus musculus GN=Birc6 PE=1 SV=2 Back     alignment and function description
>sp|P98170|XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens GN=XIAP PE=1 SV=2 Back     alignment and function description
>sp|Q13489|BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens GN=BIRC3 PE=1 SV=2 Back     alignment and function description
>sp|A5D8Q0|XIAP_XENLA E3 ubiquitin-protein ligase XIAP OS=Xenopus laevis GN=xiap PE=2 SV=2 Back     alignment and function description
>sp|Q804H7|BI52B_XENLA Baculoviral IAP repeat-containing protein 5.2-B OS=Xenopus laevis GN=birc5.2-b PE=1 SV=2 Back     alignment and function description
>sp|Q50L39|BI52A_XENLA Baculoviral IAP repeat-containing protein 5.2-A OS=Xenopus laevis GN=birc5.2-a PE=1 SV=1 Back     alignment and function description
>sp|Q28H51|BIR51_XENTR Baculoviral IAP repeat-containing protein 5.1 OS=Xenopus tropicalis GN=birc5.1 PE=2 SV=1 Back     alignment and function description
>sp|Q9R0I6|XIAP_RAT E3 ubiquitin-protein ligase XIAP OS=Rattus norvegicus GN=Xiap PE=2 SV=1 Back     alignment and function description
>sp|Q28ER3|BIR52_XENTR Baculoviral IAP repeat-containing protein 5.2 OS=Xenopus tropicalis GN=birc5.2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query828
322801272 4658 hypothetical protein SINV_06830 [Solenop 0.317 0.056 0.553 2e-75
307177514 4631 Baculoviral IAP repeat-containing protei 0.317 0.056 0.549 6e-75
332021138 2155 Baculoviral IAP repeat-containing protei 0.315 0.121 0.549 6e-75
307204788 4725 Baculoviral IAP repeat-containing protei 0.315 0.055 0.567 8e-73
345487544 4678 PREDICTED: LOW QUALITY PROTEIN: baculovi 0.301 0.053 0.55 2e-72
383863627 4608 PREDICTED: baculoviral IAP repeat-contai 0.304 0.054 0.538 5e-70
340714030 4613 PREDICTED: baculoviral IAP repeat-contai 0.317 0.057 0.520 3e-67
350421224 4699 PREDICTED: baculoviral IAP repeat-contai 0.317 0.055 0.520 8e-67
380025712 4640 PREDICTED: LOW QUALITY PROTEIN: baculovi 0.304 0.054 0.523 1e-66
198450976 4956 bruce [Drosophila pseudoobscura pseudoob 0.300 0.050 0.486 5e-65
>gi|322801272|gb|EFZ21959.1| hypothetical protein SINV_06830 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  290 bits (742), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 192/273 (70%), Gaps = 10/273 (3%)

Query: 20  EEEGPIVRDPD--SVIYHPNLNILIVLSRNAECIVVDINSGCVLRKCAF-AEEGQPIKGA 76
           +E+G +  D +  S+IYH NLN+L++ + +A+  V D+NSG +L++ +  A+    ++G 
Sbjct: 10  KEDGCLNVDTECKSIIYHANLNVLLITTGSAQVYVFDVNSGVILQRSSLSAKPNGKLQGI 69

Query: 77  YLPS-YDKVLLTDTKSVGVRSDYNGVLLLDTMLQTCLKSKNNPVKLEMLVSEAILLQQTL 135
           YL    DKVL TD + +G+RSDYNGVLLLDT+LQ  +    + VKLE+L+SEA +L Q L
Sbjct: 70  YLSDGIDKVLYTDGRGIGIRSDYNGVLLLDTILQIPVSKSEDIVKLELLLSEATILLQCL 129

Query: 136 KTIETTGCEFSPGLWTEVLTELETKIEAAQSEPKKSAKSQKWNIICLELKHASFKTACYS 195
           + +E  G E       EVL EL +KI  AQ+  KK  K+QKWN ICLEL H S K  C  
Sbjct: 130 QCVELPGVEH----LLEVLQELSSKIVTAQANQKKGIKAQKWNTICLELPHGSLKLVCSG 185

Query: 196 LVCELKRQNRHVPALAIASAINERLNCLHPTPFPIDSQPSDHRNLMFSEAARRETFAKWP 255
           LV ELKRQNRH+ AL IASAINERLN L P+   ++  P+D R LMFSEAARR TF KWP
Sbjct: 186 LVMELKRQNRHIAALPIASAINERLNGLLPS-LALEGGPTD-RALMFSEAARRNTFPKWP 243

Query: 256 HMDYKWALPDQMAQAGFYHQPSGTGYDRAMCFT 288
           HM+YKWALPDQMAQAGFYH+P+ TG DRAMCFT
Sbjct: 244 HMNYKWALPDQMAQAGFYHEPNATGDDRAMCFT 276

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307177514|gb|EFN66625.1| Baculoviral IAP repeat-containing protein 6 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332021138|gb|EGI61525.1| Baculoviral IAP repeat-containing protein 6 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307204788|gb|EFN83346.1| Baculoviral IAP repeat-containing protein 6 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345487544|ref|XP_001601754.2| PREDICTED: LOW QUALITY PROTEIN: baculoviral IAP repeat-containing protein 6 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383863627|ref|XP_003707281.1| PREDICTED: baculoviral IAP repeat-containing protein 6 [Megachile rotundata] Back     alignment and taxonomy information
>gi|340714030|ref|XP_003395535.1| PREDICTED: baculoviral IAP repeat-containing protein 6-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350421224|ref|XP_003492775.1| PREDICTED: baculoviral IAP repeat-containing protein 6-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380025712|ref|XP_003696612.1| PREDICTED: LOW QUALITY PROTEIN: baculoviral IAP repeat-containing protein 6-like [Apis florea] Back     alignment and taxonomy information
>gi|198450976|ref|XP_001358200.2| bruce [Drosophila pseudoobscura pseudoobscura] gi|198131278|gb|EAL27337.2| bruce [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query828
FB|FBgn0037808 4876 Bruce "Bruce" [Drosophila mela 0.305 0.051 0.490 3.8e-99
UNIPROTKB|D4A1E2851 D4A1E2 "Uncharacterized protei 0.306 0.298 0.410 4e-81
ZFIN|ZDB-GENE-091202-7 4870 birc6 "baculoviral IAP repeat- 0.306 0.052 0.414 1.3e-78
UNIPROTKB|F1NLF6 4841 BIRC6 "Uncharacterized protein 0.306 0.052 0.410 2.2e-77
UNIPROTKB|E1BE13 4863 BIRC6 "Uncharacterized protein 0.306 0.052 0.410 2.2e-77
UNIPROTKB|Q9NR09 4857 BIRC6 "Baculoviral IAP repeat- 0.306 0.052 0.410 6.2e-77
MGI|MGI:1276108 4882 Birc6 "baculoviral IAP repeat- 0.306 0.052 0.410 2.4e-76
UNIPROTKB|F1PN38 4755 BIRC6 "Uncharacterized protein 0.263 0.045 0.424 6.7e-71
UNIPROTKB|J9PAA8 2941 BIRC6 "Uncharacterized protein 0.090 0.025 0.853 4.5e-31
UNIPROTKB|Q9IA70195 BIRC2 "Inhibitor of apoptosis 0.070 0.297 0.446 4.7e-11
FB|FBgn0037808 Bruce "Bruce" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 621 (223.7 bits), Expect = 3.8e-99, Sum P(4) = 3.8e-99
 Identities = 129/263 (49%), Positives = 174/263 (66%)

Query:    31 SVIYHPNLNILIVLSRNAECIVVDINSGCVLRKCAFAEEGQPI-KGAYLPSYDKVLLTDT 89
             +V+YHP LN+L++    +   V+D NSG +L+    +  G  I  G Y+P  DK+L  D 
Sbjct:    35 NVVYHPQLNVLLLFDNGSTVKVLDANSGVILQTYHLSSNGDSIVHGRYMPLQDKILFWDG 94

Query:    90 KSVGVRSDYNGVLLLDTMLQTCLKSKNNPVKLEMLVSEAILLQQTLKTIETTGCEFSPGL 149
              ++G+R DYNGVLLLDT+LQ  +   ++ +KLE+++SEAI+ Q  +  +E+ G E  P  
Sbjct:    95 HNLGLRGDYNGVLLLDTILQAPIGQNDDYIKLEIILSEAIIFQNCITELESEGLE-CP-- 151

Query:   150 WTEVLTELETKIEAAQSEPKKSAKSQKWNIICLELKHASFKTACYSLVCELKRQNRHVPA 209
               ++  EL  KI  AQ + KK  K+Q+WN ICLE+ ++S K    ++V  LKR  RH+P 
Sbjct:   152 -CDISNELTQKINQAQLKAKKGIKAQRWNTICLEVPYSSLKLVSNNMVILLKRLERHIPV 210

Query:   210 LAIASAINERL-NCLHPTPFPID---SQPSDHRNLMFSEAARRETFAKWPHMDYKWALPD 265
             LAIASAINERL + +  +  P D   +  +  R LM SEA RR+TF KWPHMDYKWALPD
Sbjct:   211 LAIASAINERLTDMMMGSRVP-DFGWNFSNFQRVLMHSEAVRRQTFEKWPHMDYKWALPD 269

Query:   266 QMAQAGFYHQPSGTGYDRAMCFT 288
             QMAQAGFYHQPS +G DRAMCFT
Sbjct:   270 QMAQAGFYHQPSSSGEDRAMCFT 292
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
GO:0043066 "negative regulation of apoptotic process" evidence=ISS;IDA
GO:0007291 "sperm individualization" evidence=NAS
GO:0012501 "programmed cell death" evidence=IGI
GO:0007286 "spermatid development" evidence=IMP
GO:0019787 "small conjugating protein ligase activity" evidence=TAS
GO:0005622 "intracellular" evidence=IEA
UNIPROTKB|D4A1E2 D4A1E2 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091202-7 birc6 "baculoviral IAP repeat-containing 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLF6 BIRC6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BE13 BIRC6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NR09 BIRC6 "Baculoviral IAP repeat-containing protein 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1276108 Birc6 "baculoviral IAP repeat-containing 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PN38 BIRC6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9PAA8 BIRC6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9IA70 BIRC2 "Inhibitor of apoptosis 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query828
cd0002269 cd00022, BIR, Baculoviral inhibition of apoptosis 2e-20
pfam0065369 pfam00653, BIR, Inhibitor of Apoptosis domain 5e-18
smart0023871 smart00238, BIR, Baculoviral inhibition of apoptos 7e-18
cd0002269 cd00022, BIR, Baculoviral inhibition of apoptosis 2e-08
smart0023871 smart00238, BIR, Baculoviral inhibition of apoptos 2e-07
pfam0065369 pfam00653, BIR, Inhibitor of Apoptosis domain 3e-07
>gnl|CDD|237989 cd00022, BIR, Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins Back     alignment and domain information 
 Score = 85.4 bits (212), Expect = 2e-20
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 347 RFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWA 406
           R  +   W      ++   P+++A+AGFY+   G   D   CF C + L  WEP D+PW 
Sbjct: 3   RLKTFKNW----PISLKVTPEKLAEAGFYYTGRG---DEVKCFFCGLELKNWEPGDDPWE 55

Query: 407 EHERHSPCCPFVKG 420
           EH+R SP CPFV  
Sbjct: 56  EHKRWSPNCPFVLL 69

In higher eukaryotes, BIR domains inhibit apoptosis by acting as direct inhibitors of the caspase family of protease enzymes. In yeast, BIR domains are involved in regulating cytokinesis. This novel fold is stabilized by zinc tetrahedrally coordinated by one histidine and three cysteine residues and resembles a classical zinc finger. Length = 69
>gnl|CDD|216045 pfam00653, BIR, Inhibitor of Apoptosis domain Back     alignment and domain information
>gnl|CDD|197595 smart00238, BIR, Baculoviral inhibition of apoptosis protein repeat Back     alignment and domain information
>gnl|CDD|237989 cd00022, BIR, Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins Back     alignment and domain information
>gnl|CDD|197595 smart00238, BIR, Baculoviral inhibition of apoptosis protein repeat Back     alignment and domain information
>gnl|CDD|216045 pfam00653, BIR, Inhibitor of Apoptosis domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 828
KOG1101|consensus147 99.82
smart0023871 BIR Baculoviral inhibition of apoptosis protein re 99.75
PF0065370 BIR: Inhibitor of Apoptosis domain; InterPro: IPR0 99.74
cd0002269 BIR Baculoviral inhibition of apoptosis protein re 99.74
KOG1101|consensus147 99.7
smart0023871 BIR Baculoviral inhibition of apoptosis protein re 99.6
cd0002269 BIR Baculoviral inhibition of apoptosis protein re 99.54
PF0065370 BIR: Inhibitor of Apoptosis domain; InterPro: IPR0 99.52
PF07967133 zf-C3HC: C3HC zinc finger-like ; InterPro: IPR0129 93.13
PF07967133 zf-C3HC: C3HC zinc finger-like ; InterPro: IPR0129 91.51
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 86.07
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 81.65
PTZ00421493 coronin; Provisional 80.7
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 80.39
>KOG1101|consensus Back     alignment and domain information 
Probab=99.82  E-value=1.9e-21  Score=189.08  Aligned_cols=84  Identities=33%  Similarity=0.614  Sum_probs=74.2

Q ss_pred             cCCCCccccccccccccccccccccCChHHHHhCCeEeCCCCCCCCeEEeeccCCcccCcCCCCCchhhccccCCCCCcc
Q psy13379        339 GITDSGTGRFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWAEHERHSPCCPFV  418 (828)
Q Consensus       339 ~~~ss~e~RLkTF~nWP~~~kr~~~vspekLAkAGFYYtpt~~G~D~VkCF~Cg~~L~~WE~~DDP~~EH~rhsP~C~Fv  418 (828)
                      ..|..+++|++||.+||+...+  ++.|++||+|||||+|+   .|.|+||+|+++|.+|+++||||+||.||+|.|.|+
T Consensus        10 ~~~~~~~aRl~TF~~Wp~~~~~--~c~p~~lA~AGFy~~g~---~D~~~Cf~C~~~L~~We~~DDPW~EH~k~~p~C~F~   84 (147)
T KOG1101|consen   10 PKMAREEARLKTFKNWPYSDMD--KCTPEQLAEAGFYYTGK---QDCVKCFFCSGGLDDWEPGDDPWEEHAKWSPECEFL   84 (147)
T ss_pred             hhHHHHHHHHhhhhcCCCCCCC--CcCHHHHHhCCceeeCC---CCceECcccCcccccCCCCCCcHHHHHhhCCCCcee
Confidence            4567899999999999997533  79999999999999963   699999999999999999999999999999999999


Q ss_pred             ccccccccc
Q psy13379        419 KGEYTQNVP  427 (828)
Q Consensus       419 k~~~~~Nvp  427 (828)
                      +....++..
T Consensus        85 ~~~k~~e~~   93 (147)
T KOG1101|consen   85 KLKKGREFL   93 (147)
T ss_pred             ecccchhhh
Confidence            976555443

>smart00238 BIR Baculoviral inhibition of apoptosis protein repeat Back     alignment and domain information
>PF00653 BIR: Inhibitor of Apoptosis domain; InterPro: IPR001370 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>cd00022 BIR Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins Back     alignment and domain information
>KOG1101|consensus Back     alignment and domain information
>smart00238 BIR Baculoviral inhibition of apoptosis protein repeat Back     alignment and domain information
>cd00022 BIR Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins Back     alignment and domain information
>PF00653 BIR: Inhibitor of Apoptosis domain; InterPro: IPR001370 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>PF07967 zf-C3HC: C3HC zinc finger-like ; InterPro: IPR012935 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF07967 zf-C3HC: C3HC zinc finger-like ; InterPro: IPR012935 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query828
1m4m_A140 Mouse Survivin Length = 140 2e-09
3uei_A146 Crystal Structure Of Human Survivin E65a Mutant Len 3e-09
3uee_A146 Crystal Structure Of Human Survivin K62a Mutant Bou 3e-09
1f3h_A142 X-Ray Crystal Structure Of The Human Anti-Apoptotic 5e-09
3uig_A143 Crystal Structure Of Human Survivin In Complex With 6e-09
3uec_A146 Crystal Structure Of Human Survivin Bound To Histon 6e-09
2raw_A145 Crystal Structure Of The Borealin-survivin Complex 6e-09
1e31_A142 Survivin Dimer H. Sapiens Length = 142 6e-09
2rax_A123 Crystal Structure Of Borealin (20-78) Bound To Surv 8e-09
1xox_A117 Solution Structure Of Human Survivin Length = 117 9e-09
3siq_A136 Crystal Structure Of Autoinhibited Diap1-Bir1 Domai 2e-08
1sdz_A116 Crystal Structure Of Diap1 Bir1 Bound To A Reaper P 5e-08
3sip_E115 Crystal Structure Of Drice And Diap1-Bir1 Complex L 5e-08
3uw4_A92 Crystal Structure Of Ciap1 Bir3 Bound To Gdc0152 Le 7e-08
3uij_A143 Crystal Structure Of Human Survivin K62yH80W MUTANT 8e-08
3ueh_A146 Crystal Structure Of Human Survivin H80a Mutant Len 8e-08
3t6p_A345 Iap Antagonist-Induced Conformational Change In Cia 1e-07
4hy4_A115 Crystal Structure Of Ciap1 Bir3 Bound To T3170284 L 1e-07
3d9t_A97 Ciap1-Bir3 In Complex With N-Terminal Peptide From 2e-07
1qbh_A101 Solution Structure Of A Baculoviral Inhibitor Of Ap 3e-07
1c9q_A117 Average Nmr Solution Structure Of The Bir-2 Domain 3e-07
1i3o_E121 Crystal Structure Of The Complex Of Xiap-Bir2 And C 3e-07
1i4o_C141 Crystal Structure Of The XiapCASPASE-7 Complex Leng 6e-07
2uvl_A96 Human Bir3 Domain Of Baculoviral Inhibitor Of Apopt 6e-07
3mup_A122 Ciap1-Bir3 Domain In Complex With The Smac-Mimetic 8e-07
1kmc_C119 Crystal Structure Of The Caspase-7 XIAP-Bir2 Comple 1e-06
1i51_E117 Crystal Structure Of Caspase-7 Complexed With Xiap 2e-06
3hl5_A95 Crystal Structure Of Xiap Bir3 With Cs3 Length = 95 3e-06
1tw6_A133 Structure Of An Ml-IapXIAP CHIMERA BOUND TO A 9MER 3e-06
2i3h_A133 Structure Of An Ml-iap/xiap Chimera Bound To A 4-me 3e-06
3uw5_A116 Crystal Structure Of The Bir Domain Of Mliap Bound 3e-06
2vsl_A96 Crystal Structure Of Xiap Bir3 With A Bivalent Smac 3e-06
1nw9_A98 Structure Of Caspase-9 In An Inhibitory Complex Wit 3e-06
3clx_D130 Crystal Structure Of Xiap Bir3 Domain In Complex Wi 4e-06
1g73_C121 Crystal Structure Of Smac Bound To Xiap-Bir3 Domain 5e-06
4hy0_A125 Crystal Structure Of Xiap Bir3 With T3256336 Length 6e-06
1f9x_A120 Average Nmr Solution Structure Of The Bir-3 Domain 6e-06
1g3f_A117 Nmr Structure Of A 9 Residue Peptide From SmacDIABL 6e-06
3eyl_A122 Crystal Structure Of Xiap Bir3 Domain In Complex Wi 6e-06
2jk7_A116 Xiap Bir3 Bound To A Smac Mimetic Length = 116 6e-06
2opz_A109 Avpf Bound To Bir3-Xiap Length = 109 8e-06
2opy_A106 Smac Mimic Bound To Bir3-Xiap Length = 106 9e-06
1xb0_A108 Structure Of The Bir Domain Of Iap-Like Protein 2 L 1e-05
1jd6_A124 Crystal Structure Of Diap1-bir2/hid Complex Length 1e-05
1oxn_A140 Structure And Function Analysis Of Peptide Antagoni 2e-05
3f7g_A140 Structure Of The Bir Domain From Ml-Iap Bound To A 2e-05
2vm5_A106 Human Bir2 Domain Of Baculoviral Inhibitor Of Apopt 7e-05
>pdb|1M4M|A Chain A, Mouse Survivin Length = 140 Back     alignment and structure 
Iteration: 1

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 32/53 (60%)
Query: 366 PDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWAEHERHSPCCPFV 418
           P++MA+AGF H P+    D A CF C   L  WEP D P  EH +HSP C F+
Sbjct: 35  PERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFL 87
>pdb|3UEI|A Chain A, Crystal Structure Of Human Survivin E65a Mutant Length = 146 Back     alignment and structure
>pdb|3UEE|A Chain A, Crystal Structure Of Human Survivin K62a Mutant Bound To N-Terminal Histone H3 Length = 146 Back     alignment and structure
>pdb|1F3H|A Chain A, X-Ray Crystal Structure Of The Human Anti-Apoptotic Protein Survivin Length = 142 Back     alignment and structure
>pdb|3UIG|A Chain A, Crystal Structure Of Human Survivin In Complex With T3 Phosphorylated H3(1-15) Peptide Length = 143 Back     alignment and structure
>pdb|3UEC|A Chain A, Crystal Structure Of Human Survivin Bound To Histone H3 Phosphorylated On Threonine-3. Length = 146 Back     alignment and structure
>pdb|2RAW|A Chain A, Crystal Structure Of The Borealin-survivin Complex Length = 145 Back     alignment and structure
>pdb|1E31|A Chain A, Survivin Dimer H. Sapiens Length = 142 Back     alignment and structure
>pdb|2RAX|A Chain A, Crystal Structure Of Borealin (20-78) Bound To Survivin (1-120) Length = 123 Back     alignment and structure
>pdb|1XOX|A Chain A, Solution Structure Of Human Survivin Length = 117 Back     alignment and structure
>pdb|3SIQ|A Chain A, Crystal Structure Of Autoinhibited Diap1-Bir1 Domain Length = 136 Back     alignment and structure
>pdb|1SDZ|A Chain A, Crystal Structure Of Diap1 Bir1 Bound To A Reaper Peptide Length = 116 Back     alignment and structure
>pdb|3SIP|E Chain E, Crystal Structure Of Drice And Diap1-Bir1 Complex Length = 115 Back     alignment and structure
>pdb|3UW4|A Chain A, Crystal Structure Of Ciap1 Bir3 Bound To Gdc0152 Length = 92 Back     alignment and structure
>pdb|3UIJ|A Chain A, Crystal Structure Of Human Survivin K62yH80W MUTANT IN COMPLEX WITH SmacDIABLO(1-15) Peptide Length = 143 Back     alignment and structure
>pdb|3UEH|A Chain A, Crystal Structure Of Human Survivin H80a Mutant Length = 146 Back     alignment and structure
>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 Back     alignment and structure
>pdb|4HY4|A Chain A, Crystal Structure Of Ciap1 Bir3 Bound To T3170284 Length = 115 Back     alignment and structure
>pdb|3D9T|A Chain A, Ciap1-Bir3 In Complex With N-Terminal Peptide From Caspase- 9 (Atpfqe) Length = 97 Back     alignment and structure
>pdb|1QBH|A Chain A, Solution Structure Of A Baculoviral Inhibitor Of Apoptosis (Iap) Repeat Length = 101 Back     alignment and structure
>pdb|1C9Q|A Chain A, Average Nmr Solution Structure Of The Bir-2 Domain Of Xiap Length = 117 Back     alignment and structure
>pdb|1I3O|E Chain E, Crystal Structure Of The Complex Of Xiap-Bir2 And Caspase 3 Length = 121 Back     alignment and structure
>pdb|1I4O|C Chain C, Crystal Structure Of The XiapCASPASE-7 Complex Length = 141 Back     alignment and structure
>pdb|2UVL|A Chain A, Human Bir3 Domain Of Baculoviral Inhibitor Of Apoptosis Repeat-Containing 3 (Birc3) Length = 96 Back     alignment and structure
>pdb|3MUP|A Chain A, Ciap1-Bir3 Domain In Complex With The Smac-Mimetic Compound Smac037 Length = 122 Back     alignment and structure
>pdb|1KMC|C Chain C, Crystal Structure Of The Caspase-7 XIAP-Bir2 Complex Length = 119 Back     alignment and structure
>pdb|1I51|E Chain E, Crystal Structure Of Caspase-7 Complexed With Xiap Length = 117 Back     alignment and structure
>pdb|3HL5|A Chain A, Crystal Structure Of Xiap Bir3 With Cs3 Length = 95 Back     alignment and structure
>pdb|1TW6|A Chain A, Structure Of An Ml-IapXIAP CHIMERA BOUND TO A 9MER PEPTIDE DERIVED From Smac Length = 133 Back     alignment and structure
>pdb|2I3H|A Chain A, Structure Of An Ml-iap/xiap Chimera Bound To A 4-mer Peptide (avpw) Length = 133 Back     alignment and structure
>pdb|3UW5|A Chain A, Crystal Structure Of The Bir Domain Of Mliap Bound To Gdc0152 Length = 116 Back     alignment and structure
>pdb|2VSL|A Chain A, Crystal Structure Of Xiap Bir3 With A Bivalent Smac Mimetic Length = 96 Back     alignment and structure
>pdb|1NW9|A Chain A, Structure Of Caspase-9 In An Inhibitory Complex With Xiap- Bir3 Length = 98 Back     alignment and structure
>pdb|3CLX|D Chain D, Crystal Structure Of Xiap Bir3 Domain In Complex With A Smac-Mimetic Compound, Smac005 Length = 130 Back     alignment and structure
>pdb|1G73|C Chain C, Crystal Structure Of Smac Bound To Xiap-Bir3 Domain Length = 121 Back     alignment and structure
>pdb|4HY0|A Chain A, Crystal Structure Of Xiap Bir3 With T3256336 Length = 125 Back     alignment and structure
>pdb|1F9X|A Chain A, Average Nmr Solution Structure Of The Bir-3 Domain Of Xiap Length = 120 Back     alignment and structure
>pdb|1G3F|A Chain A, Nmr Structure Of A 9 Residue Peptide From SmacDIABLO Complexed To The Bir3 Domain Of Xiap Length = 117 Back     alignment and structure
>pdb|3EYL|A Chain A, Crystal Structure Of Xiap Bir3 Domain In Complex With A Smac-Mimetic Compound Length = 122 Back     alignment and structure
>pdb|2JK7|A Chain A, Xiap Bir3 Bound To A Smac Mimetic Length = 116 Back     alignment and structure
>pdb|2OPZ|A Chain A, Avpf Bound To Bir3-Xiap Length = 109 Back     alignment and structure
>pdb|2OPY|A Chain A, Smac Mimic Bound To Bir3-Xiap Length = 106 Back     alignment and structure
>pdb|1XB0|A Chain A, Structure Of The Bir Domain Of Iap-Like Protein 2 Length = 108 Back     alignment and structure
>pdb|1JD6|A Chain A, Crystal Structure Of Diap1-bir2/hid Complex Length = 124 Back     alignment and structure
>pdb|1OXN|A Chain A, Structure And Function Analysis Of Peptide Antagonists Of Melanoma Inhibitor Of Apoptosis (Ml-Iap) Length = 140 Back     alignment and structure
>pdb|3F7G|A Chain A, Structure Of The Bir Domain From Ml-Iap Bound To A Peptidomimetic Length = 140 Back     alignment and structure
>pdb|2VM5|A Chain A, Human Bir2 Domain Of Baculoviral Inhibitor Of Apoptosis Repeat-Containing 1 (Birc1) Length = 106 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query828
1se0_A116 Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspas 7e-28
1se0_A116 Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspas 2e-10
3siq_A136 Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 8e-26
3siq_A136 Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 4e-10
2qfa_A142 Baculoviral IAP repeat-containing protein 5; three 2e-23
2qfa_A142 Baculoviral IAP repeat-containing protein 5; three 1e-15
2poi_A94 Baculoviral IAP repeat-containing protein 4; zinc 8e-22
2poi_A94 Baculoviral IAP repeat-containing protein 4; zinc 4e-10
1g73_C121 Inhibitors of apoptosis-like protein ILP; helix bu 1e-21
1g73_C121 Inhibitors of apoptosis-like protein ILP; helix bu 8e-11
3d9t_A97 Baculoviral IAP repeat-containing protein 2; zinc 1e-21
3d9t_A97 Baculoviral IAP repeat-containing protein 2; zinc 4e-11
3hl5_A95 Baculoviral IAP repeat-containing protein 4; BIR, 1e-21
3hl5_A95 Baculoviral IAP repeat-containing protein 4; BIR, 3e-10
2qra_D111 XIAP, baculoviral IAP repeat-containing protein 4, 2e-21
2qra_D111 XIAP, baculoviral IAP repeat-containing protein 4, 9e-11
3mup_A122 Baculoviral IAP repeat-containing protein 2; zinc- 3e-21
3mup_A122 Baculoviral IAP repeat-containing protein 2; zinc- 7e-11
2vm5_A106 Baculoviral IAP repeat-containing protein 1; apopt 4e-21
2vm5_A106 Baculoviral IAP repeat-containing protein 1; apopt 8e-12
3m1d_A85 Baculoviral IAP repeat-containing protein 2; BIR, 4e-21
3m1d_A85 Baculoviral IAP repeat-containing protein 2; BIR, 3e-11
2i3h_A133 Baculoviral IAP repeat-containing protein 7; zinc 4e-21
2i3h_A133 Baculoviral IAP repeat-containing protein 7; zinc 6e-09
1i4o_C141 X-linked IAP, baculoviral IAP repeat-containing pr 1e-20
1i4o_C141 X-linked IAP, baculoviral IAP repeat-containing pr 1e-10
1jd5_A124 DIAP1, apoptosis 1 inhibitor; IAP, caspase activat 2e-20
1jd5_A124 DIAP1, apoptosis 1 inhibitor; IAP, caspase activat 5e-10
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 9e-17
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 5e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>1se0_A Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspase; 1.75A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1sdz_A 3sip_E Length = 116 Back     alignment and structure
 Score =  107 bits (269), Expect = 7e-28
 Identities = 30/91 (32%), Positives = 41/91 (45%), Gaps = 8/91 (8%)

Query: 347 RFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWA 406
           R  +   W  D     W    Q+AQ G Y   +G   D+  CF C V +  WE  D+P  
Sbjct: 18  RLKTFTDWPLD-----WLDKRQLAQTGMYFTHAG---DKVKCFFCGVEIGSWEQEDQPVP 69

Query: 407 EHERHSPCCPFVKGEYTQNVPLSVTYATAPA 437
           EH+R SP CP ++   T NVP++        
Sbjct: 70  EHQRWSPNCPLLRRRTTNNVPINAEALDRIL 100
>1se0_A Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspase; 1.75A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1sdz_A 3sip_E Length = 116 Back     alignment and structure
>3siq_A Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 2.40A {Drosophila melanogaster} Length = 136 Back     alignment and structure
>3siq_A Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 2.40A {Drosophila melanogaster} Length = 136 Back     alignment and structure
>2qfa_A Baculoviral IAP repeat-containing protein 5; three-helical-bundle, long helix, protein complex, alternative splicing, apoptosis, cell cycle, cell division; HET: MES; 1.40A {Homo sapiens} SCOP: g.52.1.1 PDB: 1e31_A* 4a0i_A 4a0j_A* 4a0n_A* 2raw_A 3uec_A* 3ued_A* 3uef_A 3uig_A* 3uih_A 3uii_A 1f3h_A 3uee_A 3ueg_A* 3uei_A 3ueh_A* 3uik_A 3uij_A 1m4m_A 2rax_A ... Length = 142 Back     alignment and structure
>2qfa_A Baculoviral IAP repeat-containing protein 5; three-helical-bundle, long helix, protein complex, alternative splicing, apoptosis, cell cycle, cell division; HET: MES; 1.40A {Homo sapiens} SCOP: g.52.1.1 PDB: 1e31_A* 4a0i_A 4a0j_A* 4a0n_A* 2raw_A 3uec_A* 3ued_A* 3uef_A 3uig_A* 3uih_A 3uii_A 1f3h_A 3uee_A 3ueg_A* 3uei_A 3ueh_A* 3uik_A 3uij_A 1m4m_A 2rax_A ... Length = 142 Back     alignment and structure
>2poi_A Baculoviral IAP repeat-containing protein 4; zinc finger, signaling protein/apoptosis complex; 1.80A {Homo sapiens} PDB: 2pop_B Length = 94 Back     alignment and structure
>2poi_A Baculoviral IAP repeat-containing protein 4; zinc finger, signaling protein/apoptosis complex; 1.80A {Homo sapiens} PDB: 2pop_B Length = 94 Back     alignment and structure
>1g73_C Inhibitors of apoptosis-like protein ILP; helix bundle, zinc-binding domain, apoptosis/apoptosis inhibitor complex; 2.00A {Homo sapiens} SCOP: g.52.1.1 PDB: 3cm2_D* 3clx_D* 3cm7_C* 1f9x_A 1g3f_A 1tfq_A* 1tft_A* 3eyl_A* 3g76_A* 2jk7_A* 2opz_A 2opy_A* 1xb0_A 1xb1_A Length = 121 Back     alignment and structure
>1g73_C Inhibitors of apoptosis-like protein ILP; helix bundle, zinc-binding domain, apoptosis/apoptosis inhibitor complex; 2.00A {Homo sapiens} SCOP: g.52.1.1 PDB: 3cm2_D* 3clx_D* 3cm7_C* 1f9x_A 1g3f_A 1tfq_A* 1tft_A* 3eyl_A* 3g76_A* 2jk7_A* 2opz_A 2opy_A* 1xb0_A 1xb1_A Length = 121 Back     alignment and structure
>3d9t_A Baculoviral IAP repeat-containing protein 2; zinc finger, apoptosis, cytoplasm, metal-binding, polymorphism, zinc, zinc-finger, alternative splicing, hydrolase, protease; 1.50A {Homo sapiens} SCOP: g.52.1.1 PDB: 3d9u_A 3uw4_A* 2uvl_A Length = 97 Back     alignment and structure
>3d9t_A Baculoviral IAP repeat-containing protein 2; zinc finger, apoptosis, cytoplasm, metal-binding, polymorphism, zinc, zinc-finger, alternative splicing, hydrolase, protease; 1.50A {Homo sapiens} SCOP: g.52.1.1 PDB: 3d9u_A 3uw4_A* 2uvl_A Length = 97 Back     alignment and structure
>3hl5_A Baculoviral IAP repeat-containing protein 4; BIR, apoptosis, small molecule drug discovery, structur drug design, ligase, metal-binding; HET: 9JZ; 1.80A {Homo sapiens} PDB: 1nw9_A 2vsl_A Length = 95 Back     alignment and structure
>3hl5_A Baculoviral IAP repeat-containing protein 4; BIR, apoptosis, small molecule drug discovery, structur drug design, ligase, metal-binding; HET: 9JZ; 1.80A {Homo sapiens} PDB: 1nw9_A 2vsl_A Length = 95 Back     alignment and structure
>2qra_D XIAP, baculoviral IAP repeat-containing protein 4, inhibitor; apoptosis, signaling protein, zinc binding; 2.50A {Homo sapiens} Length = 111 Back     alignment and structure
>2qra_D XIAP, baculoviral IAP repeat-containing protein 4, inhibitor; apoptosis, signaling protein, zinc binding; 2.50A {Homo sapiens} Length = 111 Back     alignment and structure
>3mup_A Baculoviral IAP repeat-containing protein 2; zinc-finger motif, apoptosis inhibitor; HET: SMK; 2.60A {Homo sapiens} PDB: 3oz1_A* Length = 122 Back     alignment and structure
>3mup_A Baculoviral IAP repeat-containing protein 2; zinc-finger motif, apoptosis inhibitor; HET: SMK; 2.60A {Homo sapiens} PDB: 3oz1_A* Length = 122 Back     alignment and structure
>2vm5_A Baculoviral IAP repeat-containing protein 1; apoptosis; 1.80A {Homo sapiens} Length = 106 Back     alignment and structure
>2vm5_A Baculoviral IAP repeat-containing protein 1; apoptosis; 1.80A {Homo sapiens} Length = 106 Back     alignment and structure
>3m1d_A Baculoviral IAP repeat-containing protein 2; BIR, apoptosis, cytoplasm, polymorphism, zinc, zinc-FIN metal binding protein; 2.00A {Homo sapiens} PDB: 3m0a_D 3m0d_D Length = 85 Back     alignment and structure
>3m1d_A Baculoviral IAP repeat-containing protein 2; BIR, apoptosis, cytoplasm, polymorphism, zinc, zinc-FIN metal binding protein; 2.00A {Homo sapiens} PDB: 3m0a_D 3m0d_D Length = 85 Back     alignment and structure
>2i3h_A Baculoviral IAP repeat-containing protein 7; zinc binding, peptide complex, apoptosis inhibition, peptidomimetic, small molecule, drug design, inhibitor/apoptosis complex; HET: BTB; 1.62A {Homo sapiens} SCOP: g.52.1.1 PDB: 2i3i_A* 3f7h_A* 3f7i_A* 3gt9_A* 3gta_A* 1tw6_A* 3uw5_A* 3f7g_A* 1oxn_A* 1oxq_A* 1oy7_A* Length = 133 Back     alignment and structure
>2i3h_A Baculoviral IAP repeat-containing protein 7; zinc binding, peptide complex, apoptosis inhibition, peptidomimetic, small molecule, drug design, inhibitor/apoptosis complex; HET: BTB; 1.62A {Homo sapiens} SCOP: g.52.1.1 PDB: 2i3i_A* 3f7h_A* 3f7i_A* 3gt9_A* 3gta_A* 1tw6_A* 3uw5_A* 3f7g_A* 1oxn_A* 1oxq_A* 1oy7_A* Length = 133 Back     alignment and structure
>1i4o_C X-linked IAP, baculoviral IAP repeat-containing protein 4; protease-inhibitor, apoptosis-hydrolase complex; 2.40A {Homo sapiens} PDB: 1kmc_C 1i51_E 1i3o_E 1c9q_A Length = 141 Back     alignment and structure
>1i4o_C X-linked IAP, baculoviral IAP repeat-containing protein 4; protease-inhibitor, apoptosis-hydrolase complex; 2.40A {Homo sapiens} PDB: 1kmc_C 1i51_E 1i3o_E 1c9q_A Length = 141 Back     alignment and structure
>1jd5_A DIAP1, apoptosis 1 inhibitor; IAP, caspase activation; 1.90A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1jd4_A 1jd6_A 1q4q_A Length = 124 Back     alignment and structure
>1jd5_A DIAP1, apoptosis 1 inhibitor; IAP, caspase activation; 1.90A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1jd4_A 1jd6_A 1q4q_A Length = 124 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query828
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 99.89
2qfa_A142 Baculoviral IAP repeat-containing protein 5; three 99.88
1i4o_C141 X-linked IAP, baculoviral IAP repeat-containing pr 99.88
3siq_A136 Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 99.88
1se0_A116 Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspas 99.87
2poi_A94 Baculoviral IAP repeat-containing protein 4; zinc 99.86
3m1d_A85 Baculoviral IAP repeat-containing protein 2; BIR, 99.86
2qra_D111 XIAP, baculoviral IAP repeat-containing protein 4, 99.85
3hl5_A95 Baculoviral IAP repeat-containing protein 4; BIR, 99.85
2vm5_A106 Baculoviral IAP repeat-containing protein 1; apopt 99.85
1jd5_A124 DIAP1, apoptosis 1 inhibitor; IAP, caspase activat 99.84
2i3h_A133 Baculoviral IAP repeat-containing protein 7; zinc 99.84
3d9t_A97 Baculoviral IAP repeat-containing protein 2; zinc 99.84
3mup_A122 Baculoviral IAP repeat-containing protein 2; zinc- 99.83
1g73_C121 Inhibitors of apoptosis-like protein ILP; helix bu 99.82
3m1d_A85 Baculoviral IAP repeat-containing protein 2; BIR, 99.78
2poi_A94 Baculoviral IAP repeat-containing protein 4; zinc 99.77
1i4o_C141 X-linked IAP, baculoviral IAP repeat-containing pr 99.77
2qra_D111 XIAP, baculoviral IAP repeat-containing protein 4, 99.75
1se0_A116 Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspas 99.75
3siq_A136 Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 99.75
2vm5_A106 Baculoviral IAP repeat-containing protein 1; apopt 99.75
3hl5_A95 Baculoviral IAP repeat-containing protein 4; BIR, 99.74
2i3h_A133 Baculoviral IAP repeat-containing protein 7; zinc 99.74
1jd5_A124 DIAP1, apoptosis 1 inhibitor; IAP, caspase activat 99.74
3d9t_A97 Baculoviral IAP repeat-containing protein 2; zinc 99.73
3mup_A122 Baculoviral IAP repeat-containing protein 2; zinc- 99.72
1g73_C121 Inhibitors of apoptosis-like protein ILP; helix bu 99.71
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 99.59
2qfa_A142 Baculoviral IAP repeat-containing protein 5; three 99.45
2kna_A104 Baculoviral IAP repeat-containing protein 4; XIAP, 95.6
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 93.78
4e54_B435 DNA damage-binding protein 2; beta barrel, double 89.45
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 88.47
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 88.1
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 86.9
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 86.77
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 86.76
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 85.77
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 85.65
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 85.39
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 85.39
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 85.34
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 85.19
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 84.94
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 84.53
4g56_B357 MGC81050 protein; protein arginine methyltransfera 84.03
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 83.5
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 83.29
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 82.89
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 82.85
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 82.54
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 82.36
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 82.17
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 82.11
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 81.97
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 81.81
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 81.77
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 81.76
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 81.62
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 81.48
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 81.46
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 81.03
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 80.8
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 80.76
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 80.74
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 80.69
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 80.46
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 80.34
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
Probab=99.89  E-value=5.9e-25  Score=236.35  Aligned_cols=74  Identities=34%  Similarity=0.732  Sum_probs=68.8

Q ss_pred             CCCCccccccccccccccccccccCChHHHHhCCeEeCCCCCCCCeEEeeccCCcccCcCCCCCchhhccccCCCCCccc
Q psy13379        340 ITDSGTGRFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWAEHERHSPCCPFVK  419 (828)
Q Consensus       340 ~~ss~e~RLkTF~nWP~~~kr~~~vspekLAkAGFYYtpt~~G~D~VkCF~Cg~~L~~WE~~DDP~~EH~rhsP~C~Fvk  419 (828)
                      .|.++++|++||.+||+.    ..++|++||+|||||+|   .+|+|+||+|++.|.+|+++||||+||+||+|+|+|++
T Consensus         2 ~m~~~~~Rl~tF~~WP~~----~~~~~~~lA~AGFyy~g---~~D~v~Cf~C~~~l~~We~~DdP~~eH~~~~p~C~f~~   74 (345)
T 3t6p_A            2 SMQTHAARMRTFMYWPSS----VPVQPEQLASAGFYYVG---RNDDVKCFSCDGGLRCWESGDDPWVEHAKWFPRCEFLI   74 (345)
T ss_dssp             TTSSHHHHHHHGGGSCTT----CSSCHHHHHHTTEEECS---STTCEEETTTCCEECCCCTTCCHHHHHHHHCTTCHHHH
T ss_pred             CCccHHHHHHHHhhCCCc----ccCCHHHHHhCCCeecC---CCCeEEecCCCCCccCCCCCCCHHHHHHHhCCCCccHH
Confidence            578899999999999975    36899999999999995   38999999999999999999999999999999999997


Q ss_pred             c
Q psy13379        420 G  420 (828)
Q Consensus       420 ~  420 (828)
                      .
T Consensus        75 ~   75 (345)
T 3t6p_A           75 R   75 (345)
T ss_dssp             H
T ss_pred             H
Confidence            5
>2qfa_A Baculoviral IAP repeat-containing protein 5; three-helical-bundle, long helix, protein complex, alternative splicing, apoptosis, cell cycle, cell division; HET: MES; 1.40A {Homo sapiens} SCOP: g.52.1.1 PDB: 1e31_A* 4a0i_A 4a0j_A* 4a0n_A* 2raw_A 3uec_A* 3ued_A* 3uef_A 3uig_A* 3uih_A 3uii_A 1f3h_A 3uee_A 3ueg_A* 3uei_A 3ueh_A* 3uik_A 3uij_A 1m4m_A 2rax_A ... Back     alignment and structure
>1i4o_C X-linked IAP, baculoviral IAP repeat-containing protein 4; protease-inhibitor, apoptosis-hydrolase complex; 2.40A {Homo sapiens} PDB: 1kmc_C 1i51_E 1i3o_E 1c9q_A Back     alignment and structure
>3siq_A Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 2.40A {Drosophila melanogaster} Back     alignment and structure
>1se0_A Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspase; 1.75A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1sdz_A 3sip_E Back     alignment and structure
>2poi_A Baculoviral IAP repeat-containing protein 4; zinc finger, signaling protein/apoptosis complex; 1.80A {Homo sapiens} PDB: 2pop_B Back     alignment and structure
>3m1d_A Baculoviral IAP repeat-containing protein 2; BIR, apoptosis, cytoplasm, polymorphism, zinc, zinc-FIN metal binding protein; 2.00A {Homo sapiens} PDB: 3m0a_D 3m0d_D Back     alignment and structure
>2qra_D XIAP, baculoviral IAP repeat-containing protein 4, inhibitor; apoptosis, signaling protein, zinc binding; 2.50A {Homo sapiens} Back     alignment and structure
>3hl5_A Baculoviral IAP repeat-containing protein 4; BIR, apoptosis, small molecule drug discovery, structur drug design, ligase, metal-binding; HET: 9JZ; 1.80A {Homo sapiens} PDB: 1nw9_A 2vsl_A Back     alignment and structure
>2vm5_A Baculoviral IAP repeat-containing protein 1; apoptosis; 1.80A {Homo sapiens} Back     alignment and structure
>1jd5_A DIAP1, apoptosis 1 inhibitor; IAP, caspase activation; 1.90A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1jd4_A 1jd6_A 1q4q_A Back     alignment and structure
>2i3h_A Baculoviral IAP repeat-containing protein 7; zinc binding, peptide complex, apoptosis inhibition, peptidomimetic, small molecule, drug design, inhibitor/apoptosis complex; HET: BTB; 1.62A {Homo sapiens} SCOP: g.52.1.1 PDB: 2i3i_A* 3f7h_A* 3f7i_A* 3gt9_A* 3gta_A* 1tw6_A* 3uw5_A* 3f7g_A* 1oxn_A* 1oxq_A* 1oy7_A* Back     alignment and structure
>3d9t_A Baculoviral IAP repeat-containing protein 2; zinc finger, apoptosis, cytoplasm, metal-binding, polymorphism, zinc, zinc-finger, alternative splicing, hydrolase, protease; 1.50A {Homo sapiens} SCOP: g.52.1.1 PDB: 3d9u_A 3uw4_A* 2uvl_A Back     alignment and structure
>3mup_A Baculoviral IAP repeat-containing protein 2; zinc-finger motif, apoptosis inhibitor; HET: SMK; 2.60A {Homo sapiens} SCOP: g.52.1.1 PDB: 3oz1_A* 4eb9_A* Back     alignment and structure
>1g73_C Inhibitors of apoptosis-like protein ILP; helix bundle, zinc-binding domain, apoptosis/apoptosis inhibitor complex; 2.00A {Homo sapiens} SCOP: g.52.1.1 PDB: 3cm2_D* 3clx_D* 3cm7_C* 1f9x_A 1g3f_A 1tfq_A* 1tft_A* 3eyl_A* 3g76_A* 2jk7_A* 2opz_A 2opy_A* 1xb0_A 1xb1_A Back     alignment and structure
>3m1d_A Baculoviral IAP repeat-containing protein 2; BIR, apoptosis, cytoplasm, polymorphism, zinc, zinc-FIN metal binding protein; 2.00A {Homo sapiens} PDB: 3m0a_D 3m0d_D Back     alignment and structure
>2poi_A Baculoviral IAP repeat-containing protein 4; zinc finger, signaling protein/apoptosis complex; 1.80A {Homo sapiens} PDB: 2pop_B Back     alignment and structure
>1i4o_C X-linked IAP, baculoviral IAP repeat-containing protein 4; protease-inhibitor, apoptosis-hydrolase complex; 2.40A {Homo sapiens} PDB: 1kmc_C 1i51_E 1i3o_E 1c9q_A Back     alignment and structure
>2qra_D XIAP, baculoviral IAP repeat-containing protein 4, inhibitor; apoptosis, signaling protein, zinc binding; 2.50A {Homo sapiens} Back     alignment and structure
>1se0_A Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspase; 1.75A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1sdz_A 3sip_E Back     alignment and structure
>3siq_A Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 2.40A {Drosophila melanogaster} Back     alignment and structure
>2vm5_A Baculoviral IAP repeat-containing protein 1; apoptosis; 1.80A {Homo sapiens} Back     alignment and structure
>3hl5_A Baculoviral IAP repeat-containing protein 4; BIR, apoptosis, small molecule drug discovery, structur drug design, ligase, metal-binding; HET: 9JZ; 1.80A {Homo sapiens} PDB: 1nw9_A 2vsl_A Back     alignment and structure
>2i3h_A Baculoviral IAP repeat-containing protein 7; zinc binding, peptide complex, apoptosis inhibition, peptidomimetic, small molecule, drug design, inhibitor/apoptosis complex; HET: BTB; 1.62A {Homo sapiens} SCOP: g.52.1.1 PDB: 2i3i_A* 3f7h_A* 3f7i_A* 3gt9_A* 3gta_A* 1tw6_A* 3uw5_A* 3f7g_A* 1oxn_A* 1oxq_A* 1oy7_A* Back     alignment and structure
>1jd5_A DIAP1, apoptosis 1 inhibitor; IAP, caspase activation; 1.90A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1jd4_A 1jd6_A 1q4q_A Back     alignment and structure
>3d9t_A Baculoviral IAP repeat-containing protein 2; zinc finger, apoptosis, cytoplasm, metal-binding, polymorphism, zinc, zinc-finger, alternative splicing, hydrolase, protease; 1.50A {Homo sapiens} SCOP: g.52.1.1 PDB: 3d9u_A 3uw4_A* 2uvl_A Back     alignment and structure
>3mup_A Baculoviral IAP repeat-containing protein 2; zinc-finger motif, apoptosis inhibitor; HET: SMK; 2.60A {Homo sapiens} SCOP: g.52.1.1 PDB: 3oz1_A* 4eb9_A* Back     alignment and structure
>1g73_C Inhibitors of apoptosis-like protein ILP; helix bundle, zinc-binding domain, apoptosis/apoptosis inhibitor complex; 2.00A {Homo sapiens} SCOP: g.52.1.1 PDB: 3cm2_D* 3clx_D* 3cm7_C* 1f9x_A 1g3f_A 1tfq_A* 1tft_A* 3eyl_A* 3g76_A* 2jk7_A* 2opz_A 2opy_A* 1xb0_A 1xb1_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2qfa_A Baculoviral IAP repeat-containing protein 5; three-helical-bundle, long helix, protein complex, alternative splicing, apoptosis, cell cycle, cell division; HET: MES; 1.40A {Homo sapiens} SCOP: g.52.1.1 PDB: 1e31_A* 4a0i_A 4a0j_A* 4a0n_A* 2raw_A 3uec_A* 3ued_A* 3uef_A 3uig_A* 3uih_A 3uii_A 1f3h_A 3uee_A 3ueg_A* 3uei_A 3ueh_A* 3uik_A 3uij_A 1m4m_A 2rax_A ... Back     alignment and structure
>2kna_A Baculoviral IAP repeat-containing protein 4; XIAP, UBA, apoptosis, ligase, metal-binding, phosphoprotein, inhibitor, thiol protease inhibitor; NMR {Homo sapiens} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 828
d1se0a_97 g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Dro 6e-25
d1se0a_97 g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Dro 1e-10
d2vsla196 g.52.1.1 (A:250-345) BIR domains of XIAP {Human (H 2e-23
d2vsla196 g.52.1.1 (A:250-345) BIR domains of XIAP {Human (H 1e-10
d2qfaa1137 g.52.1.1 (A:5-141) Anti-apoptotic protein survivin 4e-23
d2qfaa1137 g.52.1.1 (A:5-141) Anti-apoptotic protein survivin 3e-14
d2i3ha190 g.52.1.1 (A:78-167) BIR-containing protein 7 (ML-I 2e-22
d2i3ha190 g.52.1.1 (A:78-167) BIR-containing protein 7 (ML-I 1e-11
d1i3oe_111 g.52.1.1 (E:) BIR domains of XIAP {Human (Homo sap 4e-21
d1i3oe_111 g.52.1.1 (E:) BIR domains of XIAP {Human (Homo sap 4e-12
d3d9ta187 g.52.1.1 (A:260-346) 2MIHB/C-IAP-1 {Human (Homo sa 8e-21
d3d9ta187 g.52.1.1 (A:260-346) 2MIHB/C-IAP-1 {Human (Homo sa 4e-12
d1jd5a_105 g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Dro 9e-21
d1jd5a_105 g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Dro 1e-10
>d1se0a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 97 Back     information, alignment and structure

class: Small proteins
fold: Inhibitor of apoptosis (IAP) repeat
superfamily: Inhibitor of apoptosis (IAP) repeat
family: Inhibitor of apoptosis (IAP) repeat
domain: BIR domains of DIAP1
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

 Score = 97.2 bits (242), Expect = 6e-25
 Identities = 30/83 (36%), Positives = 41/83 (49%), Gaps = 8/83 (9%)

Query: 347 RFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWA 406
           R  +   W  D     W    Q+AQ G Y   +G   D+  CF C V +  WE  D+P  
Sbjct: 9   RLKTFTDWPLD-----WLDKRQLAQTGMYFTHAG---DKVKCFFCGVEIGSWEQEDQPVP 60

Query: 407 EHERHSPCCPFVKGEYTQNVPLS 429
           EH+R SP CP ++   T NVP++
Sbjct: 61  EHQRWSPNCPLLRRRTTNNVPIN 83
>d1se0a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 97 Back     information, alignment and structure
>d2vsla1 g.52.1.1 (A:250-345) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2vsla1 g.52.1.1 (A:250-345) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2qfaa1 g.52.1.1 (A:5-141) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d2qfaa1 g.52.1.1 (A:5-141) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d2i3ha1 g.52.1.1 (A:78-167) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2i3ha1 g.52.1.1 (A:78-167) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1i3oe_ g.52.1.1 (E:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1i3oe_ g.52.1.1 (E:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d3d9ta1 g.52.1.1 (A:260-346) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d3d9ta1 g.52.1.1 (A:260-346) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1jd5a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1jd5a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 105 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query828
d1se0a_97 BIR domains of DIAP1 {Fruit fly (Drosophila melano 99.87
d2vsla196 BIR domains of XIAP {Human (Homo sapiens) [TaxId: 99.86
d1i3oe_111 BIR domains of XIAP {Human (Homo sapiens) [TaxId: 99.85
d2i3ha190 BIR-containing protein 7 (ML-IAP, livin) {Human (H 99.85
d2qfaa1137 Anti-apoptotic protein survivin {Human (Homo sapie 99.85
d3d9ta187 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1jd5a_105 BIR domains of DIAP1 {Fruit fly (Drosophila melano 99.83
d1se0a_97 BIR domains of DIAP1 {Fruit fly (Drosophila melano 99.78
d2i3ha190 BIR-containing protein 7 (ML-IAP, livin) {Human (H 99.77
d3d9ta187 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d2vsla196 BIR domains of XIAP {Human (Homo sapiens) [TaxId: 99.75
d1i3oe_111 BIR domains of XIAP {Human (Homo sapiens) [TaxId: 99.74
d1jd5a_105 BIR domains of DIAP1 {Fruit fly (Drosophila melano 99.74
d2qfaa1137 Anti-apoptotic protein survivin {Human (Homo sapie 99.45
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 92.33
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 91.79
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 91.73
d1tbga_340 beta1-subunit of the signal-transducing G protein 90.65
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 90.47
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 89.89
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 89.49
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 88.43
d1tbga_340 beta1-subunit of the signal-transducing G protein 86.93
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 86.43
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 86.13
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 84.61
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 84.42
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 84.27
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 83.72
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 82.67
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 81.59
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 81.26
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 80.65
>d1se0a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Small proteins
fold: Inhibitor of apoptosis (IAP) repeat
superfamily: Inhibitor of apoptosis (IAP) repeat
family: Inhibitor of apoptosis (IAP) repeat
domain: BIR domains of DIAP1
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.87  E-value=8.7e-24  Score=189.13  Aligned_cols=83  Identities=35%  Similarity=0.702  Sum_probs=76.1

Q ss_pred             CCCCccccccccccccccccccccCChHHHHhCCeEeCCCCCCCCeEEeeccCCcccCcCCCCCchhhccccCCCCCccc
Q psy13379        340 ITDSGTGRFLSSAQWYRDDDRAIWALPDQMAQAGFYHQPSGTGDDRAMCFTCIVCLVCWEPTDEPWAEHERHSPCCPFVK  419 (828)
Q Consensus       340 ~~ss~e~RLkTF~nWP~~~kr~~~vspekLAkAGFYYtpt~~G~D~VkCF~Cg~~L~~WE~~DDP~~EH~rhsP~C~Fvk  419 (828)
                      +|..+++|++||.+||+.     .+++++||+|||||+|   ..|+|+||+|++.|.+|+.+||||+||++|+|+|+|++
T Consensus         2 dm~~e~~Rl~TF~~Wp~~-----~~~~~~LA~aGFyytg---~~D~v~C~~C~~~l~~W~~~D~p~~eH~r~~p~C~f~~   73 (97)
T d1se0a_           2 DLNREETRLKTFTDWPLD-----WLDKRQLAQTGMYFTH---AGDKVKCFFCGVEIGSWEQEDQPVPEHQRWSPNCPLLR   73 (97)
T ss_dssp             CTTBHHHHHTTCTTCCCT-----TSCHHHHHHTTEEECS---STTCEEETTTCCEEESCCTTCCHHHHHHHHCTTCTTTT
T ss_pred             chHhHHHHHHHHhhCCcC-----cCCHHHHHhcCCEECC---CCCEEEeCcCCCCcCCCCCCCCHHHHHHHHCcCCcccc
Confidence            477899999999999975     4789999999999995   38999999999999999999999999999999999999


Q ss_pred             ccccccccccc
Q psy13379        420 GEYTQNVPLSV  430 (828)
Q Consensus       420 ~~~~~Nvplsi  430 (828)
                      +..++|+|+..
T Consensus        74 ~~~~~nvp~~~   84 (97)
T d1se0a_          74 RRTTNNVPINA   84 (97)
T ss_dssp             TCCCCCBCSCH
T ss_pred             cCCCCceecCC
Confidence            98888988654
>d2vsla1 g.52.1.1 (A:250-345) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i3oe_ g.52.1.1 (E:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ha1 g.52.1.1 (A:78-167) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfaa1 g.52.1.1 (A:5-141) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d9ta1 g.52.1.1 (A:260-346) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jd5a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1se0a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2i3ha1 g.52.1.1 (A:78-167) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d9ta1 g.52.1.1 (A:260-346) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vsla1 g.52.1.1 (A:250-345) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i3oe_ g.52.1.1 (E:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jd5a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2qfaa1 g.52.1.1 (A:5-141) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure