Diaphorina citri psyllid: psy13382


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
MEWLFGRKITPEEMLRKNQRALNKAMRDLDREKQHMEQQEKKLIADIKKMAKEGQMESVKIMAKDLVRTRKYAKKFMMMKANIQAVSLKIQTLRSQNAMAEAMKGCSRAMQNMNRQMNLPQIQRILQEFEKQSEIMDMKEEMMNDAMDDAMDADEDEDETNAVVTQVLDELGLQLGDQLASIPDPASSMMSDKGKTPVAIPGGSGSNHSNNHGGGGGSTLSDADADLQARLDNLRRE
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcc
*EW****KIT*************************************************KIMAKDLVRTRKYAKKFMMMKANIQAVSLKIQTLRS******AMKGCSRAMQNMNRQMN*PQI**IL*******************************DETNAVVTQVLDELGLQLGD************************************************DLQARLDNLR**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEWLFGRKITPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGQMESVKIMAKDLVRTRKYAKKFMMMKANIQAVSLKIQTLRSQNAMAEAMKGCSRAMQNMNRQMNLPQIQRILQEFEKQSEIMDMKEEMMNDAMDDAMDADEDEDETNAVVTQVLDELGLQLGDQLASIPDPASSMMSDKGKTPVAIPGGSGSNHSNNHGGGGGSTLSDADADLQARLDNLRRE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Charged multivesicular body protein 2a Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids.very confidentQ6DFS6
Charged multivesicular body protein 2a Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids.very confidentQ7ZW25
Charged multivesicular body protein 2a homolog 2 Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and are delivered to lysosomes enabling degradation of membrane proteins.very confidentQ54DB1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005771 [CC]multivesicular bodyprobableGO:0005737, GO:0043231, GO:0043227, GO:0005770, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0031902 [CC]late endosome membraneprobableGO:0005737, GO:0005575, GO:0005770, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0043226, GO:0044422, GO:0010008
GO:0019904 [MF]protein domain specific bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0016197 [BP]endosomal transportprobableGO:0009987, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0016044 [BP]cellular membrane organizationprobableGO:0009987, GO:0016043, GO:0061024, GO:0008150, GO:0071840, GO:0044763, GO:0044699
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0015031 [BP]protein transportprobableGO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0008150, GO:0071702, GO:0051234, GO:0051179
GO:0016192 [BP]vesicle-mediated transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0000815 [CC]ESCRT III complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005737, GO:0044446, GO:0044444, GO:0044440, GO:0043231, GO:0044424, GO:0044425, GO:0005622, GO:0005768, GO:0043226, GO:0044422, GO:0010008

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GD5, chain A
Confidence level:very confident
Coverage over the Query: 11-140
View the alignment between query and template
View the model in PyMOL
Template: 3EAB, chain G
Confidence level:confident
Coverage over the Query: 159-192,219-235
View the alignment between query and template
View the model in PyMOL