Diaphorina citri psyllid: psy13396

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33

MADKYDPESLTEMLPFYYKRIFPYGPYLRWLFYGNLDNFRKREFSFTLNGDIYARYISYNSPNELKKDLIKRCPQKIDLGAIYDICPKDHLQHSVFTPKMKELVFDIDMTDYDDVRNCCSGADICEKCWRYMSIACKILDTALREDFDFQLLLWVFSGRRGIHCWVCDEAALALDGRGRSCLAEYMSVLTANPVKKVFLTGDVLHPHLKRAKLIIEDQFEKLLEEQELLSTKERQTKVLGLVSNGDIRAEIEKEWTRIGPGQDVEKWDRLVAIIKHHQAKNSDRKLKYAIEEILLELAYPRLDIHVSKGVNHLLKSPFCVHPKTGKIC

ccccccccccccHHHHHHHHHccHHHHHHHccccccccccccEEEEEEcccEEEEEcccccHHHHHHHHHHHccccEEEccEEccccccccccccccccHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEECccccEEEEECcHHHHcccHHHHHHHHHHHHHHcccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccc

*********LTEMLPFYYKRIFPYGPYLRWLFYGNLDNFRKREFSFTLNGDIYARYISYNSPNELKKDLIKRCPQKIDLGAIYDICPKDHLQHSVFTPKMKELVFDIDMTDYDDVRNCCSGADICEKCWRYMSIACKILDTALREDFDFQLLLWVFSGRRGIHCWVCDEAALALDGRGRSCLAEYMSVLTANPVKKVFLTGDVLHPHLKRAKLIIEDQFEKLLEEQELLSTKERQTKVLGLVSNGDIRAEIEKEWTRIGPGQDVEKWDRLVAIIKHHQAKNSDRKLKYAIEEILLELAYPRLDIHVSKGVNHLLKSPFCVHPKTGKI*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DNA primase small subunit	DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.	confident	O14215
DNA primase small subunit	DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.	confident	Q24317
DNA primase small subunit	DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.	confident	P20664

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005658 [CC]	alpha DNA polymerase:primase complex	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005657, GO:0005694, GO:0030894, GO:0032991, GO:0043231, GO:0043234, GO:0043601, GO:0043232, GO:0032993, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0043596, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0003697 [MF]	single-stranded DNA binding	probable	GO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0044763 [BP]	single-organism cellular process	probable	GO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZT2, chain A
Confidence level:very confident
Coverage over the Query: 7-190
View the alignment between query and template
View the model in PyMOL

Template: 1V33, chain A
Confidence level:very confident
Coverage over the Query: 8-328
View the alignment between query and template
View the model in PyMOL