Diaphorina citri psyllid: psy13420


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MRVCVDEIIANDRLFSNYYKCLMDTGACSPDGAELKMNNSSNTIIMFKSLVLVACLACIGSVLTSPAYTTKYDNVDLDEIIANDRLFTNYYKCLMDTGACSPDGAELKKVLPDAIATECGGCSDKQKEGAKKIFKFLIEKKPEEWKALEGKYDPSGSYKAKYDAQLKAL
ccccHHHHHccHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHccHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHcc
MRVCVDEIIANDRLFSNYYKCLMDTGACSPDGAELKMNNSSNTIIMFKSLVLVACLACIGSVLTSPAYTTKYDNVDLDEIIANDRLFTNYYKCLMDTGACSPDGAELKKVLPDAIATECGGCSDKQKEGAKKIFKFLIEKKPEEWKALEGKYDPSGSYKAKYDAQLKAL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRVCVDEIIANDRLFSNYYKCLMDTGACSPDGAELKMNNSSNTIIMFKSLVLVACLACIGSVLTSPAYTTKYDNVDLDEIIANDRLFTNYYKCLMDTGACSPDGAELKKVLPDAIATECGGCSDKQKEGAKKIFKFLIEKKPEEWKALEGKYDPSGSYKAKYDAQLKAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ejaculatory bulb-specific protein 3 Protein component of the posterior mating plug.confidentQ9W1C9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009615 [BP]response to virusprobableGO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0007552 [BP]metamorphosisprobableGO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GVS, chain A
Confidence level:very confident
Coverage over the Query: 65-169
View the alignment between query and template
View the model in PyMOL
Template: 2GVS, chain A
Confidence level:very confident
Coverage over the Query: 2-54
View the alignment between query and template
View the model in PyMOL