Diaphorina citri psyllid: psy13437

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MGGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVPVGTDGEYNIILIVERIGKD
cccEEEEEEEEEEccccEEEEEEEEcccEEEEccccccccccccccccccEEEEEEccCECccccccHHHHHHHHHHHcc
MGGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVPVGTDGEYNIILIVERIGKD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVPVGTDGEYNIILIVERIGKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0043186 [CC]P granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0060293, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226, GO:0045495
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DIQ, chain A
Confidence level:very confident
Coverage over the Query: 1-64
View the alignment between query and template
View the model in PyMOL