Psyllid ID: psy13437
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 80 | ||||||
| 241652783 | 311 | A kinase anchor protein, putative [Ixode | 0.85 | 0.218 | 0.558 | 1e-15 | |
| 242010558 | 714 | KH domain-containing protein C56G2.1, pu | 0.737 | 0.082 | 0.610 | 6e-15 | |
| 390346155 | 671 | PREDICTED: uncharacterized protein LOC76 | 0.862 | 0.102 | 0.507 | 2e-14 | |
| 427789997 | 692 | Hypothetical protein [Rhipicephalus pulc | 0.787 | 0.091 | 0.571 | 2e-14 | |
| 405950059 | 744 | A kinase anchor protein 1, mitochondrial | 0.837 | 0.090 | 0.544 | 2e-14 | |
| 91090284 | 536 | PREDICTED: similar to a kinase anchor pr | 0.787 | 0.117 | 0.571 | 3e-14 | |
| 170070834 | 589 | a kinase anchor protein [Culex quinquefa | 0.812 | 0.110 | 0.492 | 2e-13 | |
| 195134202 | 681 | GI11050 [Drosophila mojavensis] gi|19390 | 0.762 | 0.089 | 0.539 | 4e-13 | |
| 194763815 | 610 | GF20944 [Drosophila ananassae] gi|190618 | 0.975 | 0.127 | 0.455 | 6e-13 | |
| 195046542 | 627 | GH24358 [Drosophila grimshawi] gi|193893 | 0.762 | 0.097 | 0.532 | 1e-12 |
| >gi|241652783|ref|XP_002410418.1| A kinase anchor protein, putative [Ixodes scapularis] gi|215501634|gb|EEC11128.1| A kinase anchor protein, putative [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
Score = 87.0 bits (214), Expect = 1e-15, Method: Compositional matrix adjust.
Identities = 38/68 (55%), Positives = 48/68 (70%)
Query: 2 GGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVP 61
GGWFRA ++ C +KF+DYGGY+ L TS LRQIR+DF+ LPFQA EC LAN+ P
Sbjct: 180 GGWFRALVVGTSEDGEECDIKFLDYGGYMRLATSLLRQIRSDFMMLPFQASECYLANVQP 239
Query: 62 VGTDGEYN 69
G DG ++
Sbjct: 240 AGEDGVWS 247
|
Source: Ixodes scapularis Species: Ixodes scapularis Genus: Ixodes Family: Ixodidae Order: Ixodida Class: Arachnida Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242010558|ref|XP_002426032.1| KH domain-containing protein C56G2.1, putative [Pediculus humanus corporis] gi|212510042|gb|EEB13294.1| KH domain-containing protein C56G2.1, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|390346155|ref|XP_001199246.2| PREDICTED: uncharacterized protein LOC763319 isoform 1 [Strongylocentrotus purpuratus] gi|390346157|ref|XP_003726488.1| PREDICTED: uncharacterized protein LOC763319 isoform 2 [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|427789997|gb|JAA60450.1| Hypothetical protein [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|405950059|gb|EKC18066.1| A kinase anchor protein 1, mitochondrial [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|91090284|ref|XP_971237.1| PREDICTED: similar to a kinase anchor protein [Tribolium castaneum] gi|270013437|gb|EFA09885.1| hypothetical protein TcasGA2_TC012034 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|170070834|ref|XP_001869726.1| a kinase anchor protein [Culex quinquefasciatus] gi|167866758|gb|EDS30141.1| a kinase anchor protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|195134202|ref|XP_002011526.1| GI11050 [Drosophila mojavensis] gi|193906649|gb|EDW05516.1| GI11050 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|194763815|ref|XP_001964028.1| GF20944 [Drosophila ananassae] gi|190618953|gb|EDV34477.1| GF20944 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|195046542|ref|XP_001992176.1| GH24358 [Drosophila grimshawi] gi|193893017|gb|EDV91883.1| GH24358 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 80 | ||||||
| FB|FBgn0263987 | 607 | spoon "spoonbill" [Drosophila | 0.812 | 0.107 | 0.455 | 1.7e-11 | |
| ZFIN|ZDB-GENE-030131-5980 | 596 | akap1a "A kinase (PRKA) anchor | 0.85 | 0.114 | 0.455 | 2.1e-11 | |
| UNIPROTKB|H9L3I1 | 367 | TDRKH "Uncharacterized protein | 0.912 | 0.198 | 0.445 | 1.3e-10 | |
| RGD|620826 | 854 | Akap1 "A kinase (PRKA) anchor | 0.85 | 0.079 | 0.411 | 2.6e-10 | |
| MGI|MGI:104729 | 857 | Akap1 "A kinase (PRKA) anchor | 0.85 | 0.079 | 0.411 | 2.6e-10 | |
| UNIPROTKB|Q92667 | 903 | AKAP1 "A-kinase anchor protein | 0.85 | 0.075 | 0.397 | 3.5e-10 | |
| UNIPROTKB|E1BM36 | 833 | AKAP1 "Uncharacterized protein | 0.85 | 0.081 | 0.397 | 4e-10 | |
| UNIPROTKB|E1BMU6 | 843 | AKAP1 "Uncharacterized protein | 0.85 | 0.080 | 0.397 | 4.1e-10 | |
| UNIPROTKB|E2RKF9 | 864 | AKAP1 "Uncharacterized protein | 0.85 | 0.078 | 0.397 | 4.2e-10 | |
| UNIPROTKB|J9P6R4 | 882 | AKAP1 "Uncharacterized protein | 0.85 | 0.077 | 0.397 | 4.4e-10 |
| FB|FBgn0263987 spoon "spoonbill" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 167 (63.8 bits), Expect = 1.7e-11, P = 1.7e-11
Identities = 31/68 (45%), Positives = 48/68 (70%)
Query: 4 WFRAQILAVDVVNAS-CQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVPV 62
W+R QI+ D + C +KF+D+GGY+ + + LRQIR DF+++PFQ+ EC L+NI P+
Sbjct: 481 WYRVQIVDTDPEDEERCVIKFLDFGGYMNVGFNTLRQIRTDFMNVPFQSTECILSNIEPI 540
Query: 63 GTDGEYNI 70
G G ++I
Sbjct: 541 G--GTWSI 546
|
|
| ZFIN|ZDB-GENE-030131-5980 akap1a "A kinase (PRKA) anchor protein 1a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H9L3I1 TDRKH "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|620826 Akap1 "A kinase (PRKA) anchor protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:104729 Akap1 "A kinase (PRKA) anchor protein 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92667 AKAP1 "A-kinase anchor protein 1, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BM36 AKAP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BMU6 AKAP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RKF9 AKAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P6R4 AKAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 80 | |||
| pfam00567 | 118 | pfam00567, TUDOR, Tudor domain | 3e-15 | |
| smart00333 | 57 | smart00333, TUDOR, Tudor domain | 1e-06 | |
| cd04508 | 48 | cd04508, TUDOR, Tudor domains are found in many eu | 2e-05 |
| >gnl|CDD|215998 pfam00567, TUDOR, Tudor domain | Back alignment and domain information |
|---|
Score = 64.3 bits (157), Expect = 3e-15
Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 1/57 (1%)
Query: 2 GGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLAN 58
G W+RA+IL V + + +V F+DYG T+ S LR + ++F SLP QAI+C LA
Sbjct: 63 GKWYRAKIL-VSLDDGLVEVFFIDYGNTETVPLSDLRPLPSEFASLPPQAIKCSLAG 118
|
Length = 118 |
| >gnl|CDD|197660 smart00333, TUDOR, Tudor domain | Back alignment and domain information |
|---|
| >gnl|CDD|119391 cd04508, TUDOR, Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 80 | ||||
| 2diq_A | 110 | Solution Structure Of The Tudor Domain Of Tudor And | 1e-09 | ||
| 3fdr_A | 94 | Crystal Structure Of Tdrd2 Length = 94 | 2e-08 | ||
| 4b9x_A | 226 | Structure Of Extended Tudor Domain Td3 From Mouse T | 2e-06 | ||
| 4b9w_A | 201 | Structure Of Extended Tudor Domain Td3 From Mouse T | 3e-06 |
| >pdb|2DIQ|A Chain A, Solution Structure Of The Tudor Domain Of Tudor And Kh Domain Containing Protein Length = 110 | Back alignment and structure |
|
| >pdb|3FDR|A Chain A, Crystal Structure Of Tdrd2 Length = 94 | Back alignment and structure |
| >pdb|4B9X|A Chain A, Structure Of Extended Tudor Domain Td3 From Mouse Tdrd1 Length = 226 | Back alignment and structure |
| >pdb|4B9W|A Chain A, Structure Of Extended Tudor Domain Td3 From Mouse Tdrd1 In Complex With Mili Peptide Containing Dimethylarginine 45. Length = 201 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 80 | |||
| 2diq_A | 110 | Tudor and KH domain-containing protein; tudor doma | 6e-21 | |
| 3fdr_A | 94 | Tudor and KH domain-containing protein; TDRD2, str | 3e-18 | |
| 3ntk_A | 169 | Maternal protein tudor; tudor domain, OB-fold, GER | 2e-15 | |
| 3bdl_A | 570 | Staphylococcal nuclease domain-containing protein | 2e-14 | |
| 3pnw_C | 77 | Tudor domain-containing protein 3; FAB, structural | 2e-11 | |
| 2d9t_A | 78 | Tudor domain-containing protein 3; structural geno | 6e-10 | |
| 2hqx_A | 246 | P100 CO-activator tudor domain; human P100 tudor d | 7e-10 | |
| 2wac_A | 218 | CG7008-PA; unknown function, tudor, beta-barrel, n | 1e-09 | |
| 3s6w_A | 54 | Tudor domain-containing protein 3; methylated argi | 4e-08 | |
| 1g5v_A | 88 | SurviVal motor neuron protein 1; mRNA processing, | 2e-07 | |
| 4a4f_A | 64 | SurviVal of motor neuron-related-splicing factor; | 3e-06 | |
| 1mhn_A | 59 | SurviVal motor neuron protein; SMN, SMA, spinal mu | 6e-06 |
| >2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 Length = 110 | Back alignment and structure |
|---|
Score = 78.3 bits (193), Expect = 6e-21
Identities = 29/65 (44%), Positives = 38/65 (58%), Gaps = 1/65 (1%)
Query: 2 GGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVP 61
G W+RA++L N + + FVD+G LR +R+DFLSLPFQAIEC LA I
Sbjct: 47 GSWYRARVLGTLE-NGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARIAS 105
Query: 62 VGTDG 66
+ G
Sbjct: 106 GPSSG 110
|
| >3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* Length = 169 | Back alignment and structure |
|---|
| >3bdl_A Staphylococcal nuclease domain-containing protein 1; staphylococcal nuclease OB fold, tudor domain, cytoplasm, HOST-virus interaction, nucleus; HET: CIT; 1.90A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Length = 78 | Back alignment and structure |
|---|
| >2hqx_A P100 CO-activator tudor domain; human P100 tudor domain, proteolytic fragment, PSI, structural genomics; 1.42A {Homo sapiens} SCOP: b.34.9.1 PDB: 2hqe_A 3omc_A* 3omg_A* 2o4x_A 2e6n_A 2o4x_B Length = 246 | Back alignment and structure |
|---|
| >2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} Length = 218 | Back alignment and structure |
|---|
| >3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Length = 54 | Back alignment and structure |
|---|
| >1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Length = 88 | Back alignment and structure |
|---|
| >4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Length = 64 | Back alignment and structure |
|---|
| >1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Length = 59 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 80 | |||
| 4b9w_A | 201 | TDRD1, tudor domain-containing protein 1; replicat | 99.95 | |
| 4b9x_A | 226 | TDRD1, tudor domain-containing protein 1; replicat | 99.95 | |
| 2diq_A | 110 | Tudor and KH domain-containing protein; tudor doma | 99.92 | |
| 2wac_A | 218 | CG7008-PA; unknown function, tudor, beta-barrel, n | 99.91 | |
| 3ntk_A | 169 | Maternal protein tudor; tudor domain, OB-fold, GER | 99.9 | |
| 2hqx_A | 246 | P100 CO-activator tudor domain; human P100 tudor d | 99.89 | |
| 3fdr_A | 94 | Tudor and KH domain-containing protein; TDRD2, str | 99.89 | |
| 3bdl_A | 570 | Staphylococcal nuclease domain-containing protein | 99.88 | |
| 2eqk_A | 85 | Tudor domain-containing protein 4; structural geno | 99.74 | |
| 1mhn_A | 59 | SurviVal motor neuron protein; SMN, SMA, spinal mu | 99.72 | |
| 2d9t_A | 78 | Tudor domain-containing protein 3; structural geno | 99.72 | |
| 3pnw_C | 77 | Tudor domain-containing protein 3; FAB, structural | 99.69 | |
| 3s6w_A | 54 | Tudor domain-containing protein 3; methylated argi | 99.69 | |
| 4a4f_A | 64 | SurviVal of motor neuron-related-splicing factor; | 99.68 | |
| 1g5v_A | 88 | SurviVal motor neuron protein 1; mRNA processing, | 99.67 | |
| 2equ_A | 74 | PHD finger protein 20-like 1; tudor domain, struct | 99.32 | |
| 2ldm_A | 81 | Uncharacterized protein; PHF20, tudor domain, epig | 98.84 | |
| 3p8d_A | 67 | Medulloblastoma antigen MU-MB-50.72; tudor domain, | 98.69 | |
| 3qii_A | 85 | PHD finger protein 20; tudor domain, structural ge | 98.67 | |
| 2dig_A | 68 | Lamin-B receptor; tudor domain, integral nuclear e | 98.27 | |
| 2l8d_A | 66 | Lamin-B receptor; DNA binding protein; NMR {Gallus | 98.07 | |
| 2bud_A | 92 | Males-absent on the first protein; transferase, MO | 97.24 | |
| 3h8z_A | 128 | FragIle X mental retardation syndrome-related Pro; | 97.08 | |
| 2ro0_A | 92 | Histone acetyltransferase ESA1; HAT, chromodomain, | 96.21 | |
| 2f5k_A | 102 | MORF-related gene 15 isoform 1; beta barrel, gene | 95.9 | |
| 2eko_A | 87 | Histone acetyltransferase htatip; chromo domain, h | 95.84 | |
| 2rnz_A | 94 | Histone acetyltransferase ESA1; HAT, chromodomain, | 95.8 | |
| 4hcz_A | 58 | PHD finger protein 1; protein-peptide complex, tud | 95.47 | |
| 2lcc_A | 76 | AT-rich interactive domain-containing protein 4A; | 95.39 | |
| 1wgs_A | 133 | MYST histone acetyltransferase 1; tudor domain, MY | 95.35 | |
| 3h8z_A | 128 | FragIle X mental retardation syndrome-related Pro; | 95.25 | |
| 2eqj_A | 66 | Metal-response element-binding transcription facto | 94.44 | |
| 2e5p_A | 68 | Protein PHF1, PHD finger protein 1; tudor domain, | 93.46 | |
| 2lrq_A | 85 | Protein MRG15, NUA4 complex subunit EAF3 homolog; | 91.44 | |
| 2e5q_A | 63 | PHD finger protein 19; tudor domain, isoform B, st | 92.17 | |
| 3dlm_A | 213 | Histone-lysine N-methyltransferase setdb1; setdb1_ | 92.06 | |
| 2m0o_A | 79 | PHD finger protein 1; tudor domain, H3K36ME3 bindi | 90.57 | |
| 2qqr_A | 118 | JMJC domain-containing histone demethylation prote | 89.83 | |
| 2g3r_A | 123 | Tumor suppressor P53-binding protein 1; tandem tud | 89.63 | |
| 3db3_A | 161 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 89.2 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 88.65 | |
| 3m9q_A | 101 | Protein MALE-specific lethal-3; chromodomain, MSL3 | 87.76 | |
| 2eqm_A | 88 | PHD finger protein 20-like 1; structural genomics, | 86.37 | |
| 4eqp_A | 143 | Thermonuclease; staphylococcal nuclease, hyperstab | 84.84 | |
| 3m9p_A | 110 | MALE-specific lethal 3 homolog; chromodomain, MSL3 | 83.72 | |
| 1ssf_A | 156 | Transformation related protein 53 binding protein | 83.48 | |
| 2xdp_A | 123 | Lysine-specific demethylase 4C; oxidoreductase, hi | 82.45 |
| >4b9w_A TDRD1, tudor domain-containing protein 1; replication; HET: 2MR; 2.10A {Mus musculus} | Back alignment and structure |
|---|
Probab=99.95 E-value=4.1e-28 Score=157.42 Aligned_cols=75 Identities=32% Similarity=0.600 Sum_probs=69.7
Q ss_pred CCcEEEEEEEEEecCCCEEEEEEeeeCCeEEEccccccccchhhcCCCcceeEEEecceEeCCCCCCCCHHHHHhhhcc
Q psy13437 1 MGGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVPVGTDGEYNIILIVERIGK 79 (80)
Q Consensus 1 D~~wyRa~I~~~~~~~~~~~V~~vDyG~~~~v~~~~lr~l~~~f~~lP~qA~~c~L~~v~p~~~~~~Ws~~a~~~~f~~ 79 (80)
||.||||+|+++.+ ++.+.|+||||||++.|+.++||+||++|..+|+||++|+|+||+|. +..|+++| ++.|++
T Consensus 79 d~~wyRa~V~~~~~-~~~~~V~~vDyG~~~~v~~~~l~~l~~~f~~lP~qA~~c~L~~v~p~--~~~w~~ea-~~~f~~ 153 (201)
T 4b9w_A 79 DGNWYRALVKEILP-SGNVKVHFVDYGNVEEVTTDQLQAILPQFLLLPFQGMQCWLVDIQPP--NKHWTKEA-TARFQA 153 (201)
T ss_dssp TTEEEEEEEEEECT-TSCEEEEETTTCCEEEECGGGEEECCGGGGSSCBCCEEEEESSEECS--SSSCCHHH-HHHHHH
T ss_pred CCeEEEEEEEEECC-CCeEEEEEEccCCEEEEEHHHhccChHhHcccchhhEEEEEcCEEcC--CCCCCHHH-HHHHHH
Confidence 78999999999975 46799999999999999999999999999999999999999999998 57899999 888864
|
| >4b9x_A TDRD1, tudor domain-containing protein 1; replication; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* | Back alignment and structure |
|---|
| >2hqx_A P100 CO-activator tudor domain; human P100 tudor domain, proteolytic fragment, PSI, structural genomics; 1.42A {Homo sapiens} SCOP: b.34.9.1 PDB: 2hqe_A 3omc_A* 3omg_A* 2o4x_A 2e6n_A 2o4x_B | Back alignment and structure |
|---|
| >3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >3bdl_A Staphylococcal nuclease domain-containing protein 1; staphylococcal nuclease OB fold, tudor domain, cytoplasm, HOST-virus interaction, nucleus; HET: CIT; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2eqk_A Tudor domain-containing protein 4; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* | Back alignment and structure |
|---|
| >2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* | Back alignment and structure |
|---|
| >4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* | Back alignment and structure |
|---|
| >1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2dig_A Lamin-B receptor; tudor domain, integral nuclear envelope inner membrane protein, nuclear protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >2l8d_A Lamin-B receptor; DNA binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 | Back alignment and structure |
|---|
| >3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* | Back alignment and structure |
|---|
| >2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A | Back alignment and structure |
|---|
| >2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4hcz_A PHD finger protein 1; protein-peptide complex, tudor, histone binding, H3K36ME3, N nucleus, transcription; HET: M3L; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 | Back alignment and structure |
|---|
| >3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* | Back alignment and structure |
|---|
| >2eqj_A Metal-response element-binding transcription factor 2; structure genomics,tudor domain, zinc-regulated factor 1, ZIRF1; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2e5p_A Protein PHF1, PHD finger protein 1; tudor domain, PHF1 protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lrq_A Protein MRG15, NUA4 complex subunit EAF3 homolog; epigenetics, LID complex, transcription; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2e5q_A PHD finger protein 19; tudor domain, isoform B, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dlm_A Histone-lysine N-methyltransferase setdb1; setdb1_human, structural genomics, structural genomics consortium, SGC, alternative splicing; 1.77A {Homo sapiens} | Back alignment and structure |
|---|
| >2m0o_A PHD finger protein 1; tudor domain, H3K36ME3 binding, peptide binding protein; HET: M3L; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qqr_A JMJC domain-containing histone demethylation protein 3A; histone lysine demethylase, tandem hybrid tudor domains, metal binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 b.34.9.1 PDB: 2qqs_A* 2gfa_A* 2gf7_A* | Back alignment and structure |
|---|
| >2g3r_A Tumor suppressor P53-binding protein 1; tandem tudor domains, cell cycle-transcription complex; 1.25A {Homo sapiens} SCOP: b.34.9.1 b.34.9.1 PDB: 2ig0_A* 3lgf_A* 3lgl_A* 3lh0_A* 1xni_A | Back alignment and structure |
|---|
| >3db3_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, tandem tudor domains, LI metal binding, DNA replication; HET: M3L; 2.40A {Homo sapiens} PDB: 3db4_A 2l3r_A* | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3m9q_A Protein MALE-specific lethal-3; chromodomain, MSL3, methyllysine recognition, aromatic CAGE, complex, transcription upregulation; 1.29A {Drosophila melanogaster} SCOP: b.34.13.0 | Back alignment and structure |
|---|
| >2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A | Back alignment and structure |
|---|
| >4eqp_A Thermonuclease; staphylococcal nuclease, hyperstable, PDTP, ionizable group, hydrolase; HET: THP; 1.35A {Staphylococcus aureus} PDB: 3ero_A* 2rbm_A* 3d8g_A* 3bdc_A* 4f8m_A* 3lx0_A* 3nqt_A* 3nk9_A* 3pmf_A* 3sr1_A* 3t13_A* 3mxp_A* 3r3o_A* 4df7_A* 3np8_A* 3nxw_A* 3oso_A* 3mz5_A* 3mhb_A* 3dhq_A* ... | Back alignment and structure |
|---|
| >1ssf_A Transformation related protein 53 binding protein 1; tudor domains, tandem, SH3-like fold, beta barrel, alpha- helix, cell cycle; NMR {Mus musculus} SCOP: b.34.9.1 b.34.9.1 | Back alignment and structure |
|---|
| >2xdp_A Lysine-specific demethylase 4C; oxidoreductase, histone modification; 1.56A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 80 | ||||
| d2diqa1 | 97 | b.34.9.1 (A:8-104) Tudor and KH domain-containing | 1e-17 | |
| d2hqxa1 | 90 | b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human ( | 7e-12 | |
| d2d9ta1 | 60 | b.34.9.1 (A:8-67) Tudor domain-containing protein | 1e-09 | |
| d1mhna_ | 59 | b.34.9.1 (A:) Survival motor neuron protein 1, smn | 6e-06 |
| >d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: Tudor/PWWP/MBT family: Tudor domain domain: Tudor and KH domain-containing protein TDRKH species: Human (Homo sapiens) [TaxId: 9606]
Score = 68.8 bits (168), Expect = 1e-17
Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
Query: 2 GGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANI 59
G W+RA++L N + + FVD+G LR +R+DFLSLPFQAIEC LA I
Sbjct: 40 GSWYRARVLGTLE-NGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARI 96
|
| >d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 60 | Back information, alignment and structure |
|---|
| >d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 80 | |||
| d2diqa1 | 97 | Tudor and KH domain-containing protein TDRKH {Huma | 99.9 | |
| d2hqxa1 | 90 | P100 co-activator, SND1 {Human (Homo sapiens) [Tax | 99.82 | |
| d2d9ta1 | 60 | Tudor domain-containing protein 3, TDRD3 {Mouse (M | 99.72 | |
| d1mhna_ | 59 | Survival motor neuron protein 1, smn {Human (Homo | 99.7 | |
| d2buda1 | 88 | Putative histone acetyltransferase MOF {Fruit fly | 96.63 | |
| d1wgsa_ | 133 | Probable histone acetyltransferase MYST1 {Mouse (M | 95.67 | |
| d2qqra1 | 59 | Jumonji domain-containing protein 2A {Human (Homo | 93.86 | |
| d2qqra2 | 56 | Jumonji domain-containing protein 2A {Human (Homo | 91.09 | |
| d2diga1 | 55 | Lamin-b receptor {Human (Homo sapiens) [TaxId: 960 | 85.88 |
| >d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: Tudor/PWWP/MBT family: Tudor domain domain: Tudor and KH domain-containing protein TDRKH species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90 E-value=3.6e-25 Score=127.71 Aligned_cols=58 Identities=48% Similarity=0.834 Sum_probs=54.9
Q ss_pred CCcEEEEEEEEEecCCCEEEEEEeeeCCeEEEccccccccchhhcCCCcceeEEEecce
Q psy13437 1 MGGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANI 59 (80)
Q Consensus 1 D~~wyRa~I~~~~~~~~~~~V~~vDyG~~~~v~~~~lr~l~~~f~~lP~qA~~c~L~~v 59 (80)
||.||||+|+++.. ++.+.|+|||||+++.|+.++||.|+++|..+|+||++|+|+||
T Consensus 39 d~~wyRa~V~~~~~-~~~~~V~~vDyG~~~~v~~~~l~~l~~~~~~lP~~A~~c~L~~v 96 (97)
T d2diqa1 39 NGSWYRARVLGTLE-NGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARI 96 (97)
T ss_dssp TCSCEEEEECCCCS-SSCEEEEETTTCCEEEECGGGCEECCHHHHSSCCSSCCSCSSCS
T ss_pred CCeEEEEEEEEECC-CCEEEEEEEeeCCEEEEeHHHhhccCHHHhhCChhhEEEEECcC
Confidence 78999999999875 46799999999999999999999999999999999999999997
|
| >d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qqra1 b.34.9.1 (A:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qqra2 b.34.9.1 (A:956-1011) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2diga1 b.34.9.1 (A:8-62) Lamin-b receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|