Psyllid ID: psy13437


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MGGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVPVGTDGEYNIILIVERIGKD
cccEEEEEEEEEEccccEEEEEEEEcccEEEEccccccccccccccccccEEEEEEccEEEcccccHHHHHHHHHHHHcc
cccEEEEEEEEEcccccEEEEEEEEcccccEEcHHHHHcccHHHHcccHHHEEEEEcccccccccccHHHHHHHHHHccc
MGGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFqaiecglanivpvgtdgeyNIILIVERIGKD
MGGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLanivpvgtdgeYNIILIVERIGKD
MGGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVPVGTDGEYNIILIVERIGKD
**GWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVPVGTDGEYNIILIVERI***
MGGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVPVGTDGEYNIILIVERIGKD
MGGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVPVGTDGEYNIILIVERIGKD
*GGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVPVGTDGEYNIILIVERIGK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVPVGTDGEYNIILIVERIGKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query80 2.2.26 [Sep-21-2011]
O88884854 A-kinase anchor protein 1 yes N/A 0.85 0.079 0.411 9e-12
O08715857 A-kinase anchor protein 1 yes N/A 0.85 0.079 0.411 9e-12
Q92667903 A-kinase anchor protein 1 yes N/A 0.85 0.075 0.397 1e-11
Q80VL1 560 Tudor and KH domain-conta no N/A 0.762 0.108 0.483 3e-10
Q9Y2W6 561 Tudor and KH domain-conta no N/A 0.812 0.115 0.469 3e-10
Q09285867 KH domain-containing prot no N/A 0.812 0.074 0.477 3e-09
Q9BXT4 1180 Tudor domain-containing p no N/A 0.712 0.048 0.431 8e-07
A9CPT4 1133 Tudor domain-containing p N/A N/A 0.75 0.052 0.409 1e-06
Q58EK5 1175 Tudor domain-containing p no N/A 0.725 0.049 0.423 3e-06
Q99MV1 1172 Tudor domain-containing p no N/A 0.737 0.050 0.383 1e-05
>sp|O88884|AKAP1_RAT A-kinase anchor protein 1, mitochondrial OS=Rattus norvegicus GN=Akap1 PE=2 SV=1 Back     alignment and function desciption
 Score = 68.9 bits (167), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 45/68 (66%)

Query: 2   GGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVP 61
           G W+RAQ++A        ++++VDYGGY  ++   LRQIR+DF++LPFQ  E  L ++VP
Sbjct: 723 GAWWRAQVVASYEETNEVEIRYVDYGGYKRVKVDVLRQIRSDFVTLPFQGAEVLLDSVVP 782

Query: 62  VGTDGEYN 69
           +  D  ++
Sbjct: 783 LSDDDHFS 790




Binds to type I and II regulatory subunits of protein kinase A and anchors them to the cytoplasmic face of the mitochondrial outer membrane.
Rattus norvegicus (taxid: 10116)
>sp|O08715|AKAP1_MOUSE A-kinase anchor protein 1, mitochondrial OS=Mus musculus GN=Akap1 PE=1 SV=4 Back     alignment and function description
>sp|Q92667|AKAP1_HUMAN A-kinase anchor protein 1, mitochondrial OS=Homo sapiens GN=AKAP1 PE=1 SV=1 Back     alignment and function description
>sp|Q80VL1|TDRKH_MOUSE Tudor and KH domain-containing protein OS=Mus musculus GN=Tdrkh PE=1 SV=1 Back     alignment and function description
>sp|Q9Y2W6|TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens GN=TDRKH PE=1 SV=2 Back     alignment and function description
>sp|Q09285|YQK1_CAEEL KH domain-containing protein C56G2.1 OS=Caenorhabditis elegans GN=C56G2.1/C56G2.2 PE=4 SV=2 Back     alignment and function description
>sp|Q9BXT4|TDRD1_HUMAN Tudor domain-containing protein 1 OS=Homo sapiens GN=TDRD1 PE=2 SV=2 Back     alignment and function description
>sp|A9CPT4|TDRD1_ORYLA Tudor domain-containing protein 1 OS=Oryzias latipes GN=tdrd1 PE=2 SV=1 Back     alignment and function description
>sp|Q58EK5|TDRD1_DANRE Tudor domain-containing protein 1 OS=Danio rerio GN=tdrd1 PE=2 SV=2 Back     alignment and function description
>sp|Q99MV1|TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus GN=Tdrd1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
241652783 311 A kinase anchor protein, putative [Ixode 0.85 0.218 0.558 1e-15
242010558 714 KH domain-containing protein C56G2.1, pu 0.737 0.082 0.610 6e-15
390346155 671 PREDICTED: uncharacterized protein LOC76 0.862 0.102 0.507 2e-14
427789997 692 Hypothetical protein [Rhipicephalus pulc 0.787 0.091 0.571 2e-14
405950059 744 A kinase anchor protein 1, mitochondrial 0.837 0.090 0.544 2e-14
91090284 536 PREDICTED: similar to a kinase anchor pr 0.787 0.117 0.571 3e-14
170070834 589 a kinase anchor protein [Culex quinquefa 0.812 0.110 0.492 2e-13
195134202 681 GI11050 [Drosophila mojavensis] gi|19390 0.762 0.089 0.539 4e-13
194763815 610 GF20944 [Drosophila ananassae] gi|190618 0.975 0.127 0.455 6e-13
195046542 627 GH24358 [Drosophila grimshawi] gi|193893 0.762 0.097 0.532 1e-12
>gi|241652783|ref|XP_002410418.1| A kinase anchor protein, putative [Ixodes scapularis] gi|215501634|gb|EEC11128.1| A kinase anchor protein, putative [Ixodes scapularis] Back     alignment and taxonomy information
 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 48/68 (70%)

Query: 2   GGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVP 61
           GGWFRA ++        C +KF+DYGGY+ L TS LRQIR+DF+ LPFQA EC LAN+ P
Sbjct: 180 GGWFRALVVGTSEDGEECDIKFLDYGGYMRLATSLLRQIRSDFMMLPFQASECYLANVQP 239

Query: 62  VGTDGEYN 69
            G DG ++
Sbjct: 240 AGEDGVWS 247




Source: Ixodes scapularis

Species: Ixodes scapularis

Genus: Ixodes

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242010558|ref|XP_002426032.1| KH domain-containing protein C56G2.1, putative [Pediculus humanus corporis] gi|212510042|gb|EEB13294.1| KH domain-containing protein C56G2.1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|390346155|ref|XP_001199246.2| PREDICTED: uncharacterized protein LOC763319 isoform 1 [Strongylocentrotus purpuratus] gi|390346157|ref|XP_003726488.1| PREDICTED: uncharacterized protein LOC763319 isoform 2 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|427789997|gb|JAA60450.1| Hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|405950059|gb|EKC18066.1| A kinase anchor protein 1, mitochondrial [Crassostrea gigas] Back     alignment and taxonomy information
>gi|91090284|ref|XP_971237.1| PREDICTED: similar to a kinase anchor protein [Tribolium castaneum] gi|270013437|gb|EFA09885.1| hypothetical protein TcasGA2_TC012034 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170070834|ref|XP_001869726.1| a kinase anchor protein [Culex quinquefasciatus] gi|167866758|gb|EDS30141.1| a kinase anchor protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195134202|ref|XP_002011526.1| GI11050 [Drosophila mojavensis] gi|193906649|gb|EDW05516.1| GI11050 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|194763815|ref|XP_001964028.1| GF20944 [Drosophila ananassae] gi|190618953|gb|EDV34477.1| GF20944 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195046542|ref|XP_001992176.1| GH24358 [Drosophila grimshawi] gi|193893017|gb|EDV91883.1| GH24358 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
FB|FBgn0263987607 spoon "spoonbill" [Drosophila 0.812 0.107 0.455 1.7e-11
ZFIN|ZDB-GENE-030131-5980596 akap1a "A kinase (PRKA) anchor 0.85 0.114 0.455 2.1e-11
UNIPROTKB|H9L3I1367 TDRKH "Uncharacterized protein 0.912 0.198 0.445 1.3e-10
RGD|620826854 Akap1 "A kinase (PRKA) anchor 0.85 0.079 0.411 2.6e-10
MGI|MGI:104729857 Akap1 "A kinase (PRKA) anchor 0.85 0.079 0.411 2.6e-10
UNIPROTKB|Q92667903 AKAP1 "A-kinase anchor protein 0.85 0.075 0.397 3.5e-10
UNIPROTKB|E1BM36833 AKAP1 "Uncharacterized protein 0.85 0.081 0.397 4e-10
UNIPROTKB|E1BMU6843 AKAP1 "Uncharacterized protein 0.85 0.080 0.397 4.1e-10
UNIPROTKB|E2RKF9864 AKAP1 "Uncharacterized protein 0.85 0.078 0.397 4.2e-10
UNIPROTKB|J9P6R4882 AKAP1 "Uncharacterized protein 0.85 0.077 0.397 4.4e-10
FB|FBgn0263987 spoon "spoonbill" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 167 (63.8 bits), Expect = 1.7e-11, P = 1.7e-11
 Identities = 31/68 (45%), Positives = 48/68 (70%)

Query:     4 WFRAQILAVDVVNAS-CQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVPV 62
             W+R QI+  D  +   C +KF+D+GGY+ +  + LRQIR DF+++PFQ+ EC L+NI P+
Sbjct:   481 WYRVQIVDTDPEDEERCVIKFLDFGGYMNVGFNTLRQIRTDFMNVPFQSTECILSNIEPI 540

Query:    63 GTDGEYNI 70
             G  G ++I
Sbjct:   541 G--GTWSI 546




GO:0008104 "protein localization" evidence=ISS
GO:0051018 "protein kinase A binding" evidence=ISS
GO:0006403 "RNA localization" evidence=IMP
GO:0003723 "RNA binding" evidence=IEA
GO:0046843 "dorsal appendage formation" evidence=IMP
GO:0008298 "intracellular mRNA localization" evidence=IMP
GO:0008069 "dorsal/ventral axis specification, ovarian follicular epithelium" evidence=IMP
GO:0051276 "chromosome organization" evidence=IMP
GO:0060269 "centripetally migrating follicle cell migration" evidence=IMP
GO:0007298 "border follicle cell migration" evidence=IMP
GO:0008070 "maternal determination of dorsal/ventral axis, ovarian follicular epithelium, germ-line encoded" evidence=IMP
GO:0030837 "negative regulation of actin filament polymerization" evidence=IGI;IMP
GO:0006099 "tricarboxylic acid cycle" evidence=IDA
GO:0007616 "long-term memory" evidence=IMP
GO:0005739 "mitochondrion" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
ZFIN|ZDB-GENE-030131-5980 akap1a "A kinase (PRKA) anchor protein 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H9L3I1 TDRKH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|620826 Akap1 "A kinase (PRKA) anchor protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:104729 Akap1 "A kinase (PRKA) anchor protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q92667 AKAP1 "A-kinase anchor protein 1, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BM36 AKAP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BMU6 AKAP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RKF9 AKAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P6R4 AKAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
pfam00567118 pfam00567, TUDOR, Tudor domain 3e-15
smart0033357 smart00333, TUDOR, Tudor domain 1e-06
cd0450848 cd04508, TUDOR, Tudor domains are found in many eu 2e-05
>gnl|CDD|215998 pfam00567, TUDOR, Tudor domain Back     alignment and domain information
 Score = 64.3 bits (157), Expect = 3e-15
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 2   GGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLAN 58
           G W+RA+IL V + +   +V F+DYG   T+  S LR + ++F SLP QAI+C LA 
Sbjct: 63  GKWYRAKIL-VSLDDGLVEVFFIDYGNTETVPLSDLRPLPSEFASLPPQAIKCSLAG 118


Length = 118

>gnl|CDD|197660 smart00333, TUDOR, Tudor domain Back     alignment and domain information
>gnl|CDD|119391 cd04508, TUDOR, Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
2diq_A110 Solution Structure Of The Tudor Domain Of Tudor And 1e-09
3fdr_A94 Crystal Structure Of Tdrd2 Length = 94 2e-08
4b9x_A226 Structure Of Extended Tudor Domain Td3 From Mouse T 2e-06
4b9w_A201 Structure Of Extended Tudor Domain Td3 From Mouse T 3e-06
>pdb|2DIQ|A Chain A, Solution Structure Of The Tudor Domain Of Tudor And Kh Domain Containing Protein Length = 110 Back     alignment and structure

Iteration: 1

Score = 58.2 bits (139), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 29/65 (44%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Query: 2 GGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVP 61 G W+RA++L + N + + FVD+G LR +R+DFLSLPFQAIEC LA I Sbjct: 47 GSWYRARVLGT-LENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARIAS 105 Query: 62 VGTDG 66 + G Sbjct: 106 GPSSG 110
>pdb|3FDR|A Chain A, Crystal Structure Of Tdrd2 Length = 94 Back     alignment and structure
>pdb|4B9X|A Chain A, Structure Of Extended Tudor Domain Td3 From Mouse Tdrd1 Length = 226 Back     alignment and structure
>pdb|4B9W|A Chain A, Structure Of Extended Tudor Domain Td3 From Mouse Tdrd1 In Complex With Mili Peptide Containing Dimethylarginine 45. Length = 201 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
2diq_A110 Tudor and KH domain-containing protein; tudor doma 6e-21
3fdr_A94 Tudor and KH domain-containing protein; TDRD2, str 3e-18
3ntk_A169 Maternal protein tudor; tudor domain, OB-fold, GER 2e-15
3bdl_A570 Staphylococcal nuclease domain-containing protein 2e-14
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 2e-11
2d9t_A78 Tudor domain-containing protein 3; structural geno 6e-10
2hqx_A246 P100 CO-activator tudor domain; human P100 tudor d 7e-10
2wac_A218 CG7008-PA; unknown function, tudor, beta-barrel, n 1e-09
3s6w_A54 Tudor domain-containing protein 3; methylated argi 4e-08
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 2e-07
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 3e-06
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 6e-06
>2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 Length = 110 Back     alignment and structure
 Score = 78.3 bits (193), Expect = 6e-21
 Identities = 29/65 (44%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 2   GGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVP 61
           G W+RA++L     N +  + FVD+G         LR +R+DFLSLPFQAIEC LA I  
Sbjct: 47  GSWYRARVLGTLE-NGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARIAS 105

Query: 62  VGTDG 66
             + G
Sbjct: 106 GPSSG 110


>3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} Length = 94 Back     alignment and structure
>3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* Length = 169 Back     alignment and structure
>3bdl_A Staphylococcal nuclease domain-containing protein 1; staphylococcal nuclease OB fold, tudor domain, cytoplasm, HOST-virus interaction, nucleus; HET: CIT; 1.90A {Homo sapiens} Length = 570 Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Length = 77 Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Length = 78 Back     alignment and structure
>2hqx_A P100 CO-activator tudor domain; human P100 tudor domain, proteolytic fragment, PSI, structural genomics; 1.42A {Homo sapiens} SCOP: b.34.9.1 PDB: 2hqe_A 3omc_A* 3omg_A* 2o4x_A 2e6n_A 2o4x_B Length = 246 Back     alignment and structure
>2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} Length = 218 Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Length = 54 Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Length = 88 Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Length = 64 Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Length = 59 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
4b9w_A201 TDRD1, tudor domain-containing protein 1; replicat 99.95
4b9x_A226 TDRD1, tudor domain-containing protein 1; replicat 99.95
2diq_A110 Tudor and KH domain-containing protein; tudor doma 99.92
2wac_A218 CG7008-PA; unknown function, tudor, beta-barrel, n 99.91
3ntk_A169 Maternal protein tudor; tudor domain, OB-fold, GER 99.9
2hqx_A246 P100 CO-activator tudor domain; human P100 tudor d 99.89
3fdr_A94 Tudor and KH domain-containing protein; TDRD2, str 99.89
3bdl_A570 Staphylococcal nuclease domain-containing protein 99.88
2eqk_A85 Tudor domain-containing protein 4; structural geno 99.74
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 99.72
2d9t_A78 Tudor domain-containing protein 3; structural geno 99.72
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 99.69
3s6w_A54 Tudor domain-containing protein 3; methylated argi 99.69
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 99.68
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 99.67
2equ_A74 PHD finger protein 20-like 1; tudor domain, struct 99.32
2ldm_A81 Uncharacterized protein; PHF20, tudor domain, epig 98.84
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 98.69
3qii_A85 PHD finger protein 20; tudor domain, structural ge 98.67
2dig_A68 Lamin-B receptor; tudor domain, integral nuclear e 98.27
2l8d_A66 Lamin-B receptor; DNA binding protein; NMR {Gallus 98.07
2bud_A92 Males-absent on the first protein; transferase, MO 97.24
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 97.08
2ro0_A92 Histone acetyltransferase ESA1; HAT, chromodomain, 96.21
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 95.9
2eko_A87 Histone acetyltransferase htatip; chromo domain, h 95.84
2rnz_A94 Histone acetyltransferase ESA1; HAT, chromodomain, 95.8
4hcz_A58 PHD finger protein 1; protein-peptide complex, tud 95.47
2lcc_A76 AT-rich interactive domain-containing protein 4A; 95.39
1wgs_A133 MYST histone acetyltransferase 1; tudor domain, MY 95.35
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 95.25
2eqj_A66 Metal-response element-binding transcription facto 94.44
2e5p_A68 Protein PHF1, PHD finger protein 1; tudor domain, 93.46
2lrq_A85 Protein MRG15, NUA4 complex subunit EAF3 homolog; 91.44
2e5q_A63 PHD finger protein 19; tudor domain, isoform B, st 92.17
3dlm_A 213 Histone-lysine N-methyltransferase setdb1; setdb1_ 92.06
2m0o_A79 PHD finger protein 1; tudor domain, H3K36ME3 bindi 90.57
2qqr_A118 JMJC domain-containing histone demethylation prote 89.83
2g3r_A123 Tumor suppressor P53-binding protein 1; tandem tud 89.63
3db3_A161 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 89.2
3ask_A 226 E3 ubiquitin-protein ligase UHRF1; histone reader 88.65
3m9q_A101 Protein MALE-specific lethal-3; chromodomain, MSL3 87.76
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 86.37
4eqp_A143 Thermonuclease; staphylococcal nuclease, hyperstab 84.84
3m9p_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 83.72
1ssf_A156 Transformation related protein 53 binding protein 83.48
2xdp_A123 Lysine-specific demethylase 4C; oxidoreductase, hi 82.45
>4b9w_A TDRD1, tudor domain-containing protein 1; replication; HET: 2MR; 2.10A {Mus musculus} Back     alignment and structure
Probab=99.95  E-value=4.1e-28  Score=157.42  Aligned_cols=75  Identities=32%  Similarity=0.600  Sum_probs=69.7

Q ss_pred             CCcEEEEEEEEEecCCCEEEEEEeeeCCeEEEccccccccchhhcCCCcceeEEEecceEeCCCCCCCCHHHHHhhhcc
Q psy13437          1 MGGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANIVPVGTDGEYNIILIVERIGK   79 (80)
Q Consensus         1 D~~wyRa~I~~~~~~~~~~~V~~vDyG~~~~v~~~~lr~l~~~f~~lP~qA~~c~L~~v~p~~~~~~Ws~~a~~~~f~~   79 (80)
                      ||.||||+|+++.+ ++.+.|+||||||++.|+.++||+||++|..+|+||++|+|+||+|.  +..|+++| ++.|++
T Consensus        79 d~~wyRa~V~~~~~-~~~~~V~~vDyG~~~~v~~~~l~~l~~~f~~lP~qA~~c~L~~v~p~--~~~w~~ea-~~~f~~  153 (201)
T 4b9w_A           79 DGNWYRALVKEILP-SGNVKVHFVDYGNVEEVTTDQLQAILPQFLLLPFQGMQCWLVDIQPP--NKHWTKEA-TARFQA  153 (201)
T ss_dssp             TTEEEEEEEEEECT-TSCEEEEETTTCCEEEECGGGEEECCGGGGSSCBCCEEEEESSEECS--SSSCCHHH-HHHHHH
T ss_pred             CCeEEEEEEEEECC-CCeEEEEEEccCCEEEEEHHHhccChHhHcccchhhEEEEEcCEEcC--CCCCCHHH-HHHHHH
Confidence            78999999999975 46799999999999999999999999999999999999999999998  57899999 888864



>4b9x_A TDRD1, tudor domain-containing protein 1; replication; 2.80A {Mus musculus} Back     alignment and structure
>2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* Back     alignment and structure
>2hqx_A P100 CO-activator tudor domain; human P100 tudor domain, proteolytic fragment, PSI, structural genomics; 1.42A {Homo sapiens} SCOP: b.34.9.1 PDB: 2hqe_A 3omc_A* 3omg_A* 2o4x_A 2e6n_A 2o4x_B Back     alignment and structure
>3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3bdl_A Staphylococcal nuclease domain-containing protein 1; staphylococcal nuclease OB fold, tudor domain, cytoplasm, HOST-virus interaction, nucleus; HET: CIT; 1.90A {Homo sapiens} Back     alignment and structure
>2eqk_A Tudor domain-containing protein 4; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>2dig_A Lamin-B receptor; tudor domain, integral nuclear envelope inner membrane protein, nuclear protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2l8d_A Lamin-B receptor; DNA binding protein; NMR {Gallus gallus} Back     alignment and structure
>2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Back     alignment and structure
>2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4hcz_A PHD finger protein 1; protein-peptide complex, tudor, histone binding, H3K36ME3, N nucleus, transcription; HET: M3L; 1.85A {Homo sapiens} Back     alignment and structure
>2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>2eqj_A Metal-response element-binding transcription factor 2; structure genomics,tudor domain, zinc-regulated factor 1, ZIRF1; NMR {Mus musculus} Back     alignment and structure
>2e5p_A Protein PHF1, PHD finger protein 1; tudor domain, PHF1 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lrq_A Protein MRG15, NUA4 complex subunit EAF3 homolog; epigenetics, LID complex, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>2e5q_A PHD finger protein 19; tudor domain, isoform B, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dlm_A Histone-lysine N-methyltransferase setdb1; setdb1_human, structural genomics, structural genomics consortium, SGC, alternative splicing; 1.77A {Homo sapiens} Back     alignment and structure
>2m0o_A PHD finger protein 1; tudor domain, H3K36ME3 binding, peptide binding protein; HET: M3L; NMR {Homo sapiens} Back     alignment and structure
>2qqr_A JMJC domain-containing histone demethylation protein 3A; histone lysine demethylase, tandem hybrid tudor domains, metal binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 b.34.9.1 PDB: 2qqs_A* 2gfa_A* 2gf7_A* Back     alignment and structure
>2g3r_A Tumor suppressor P53-binding protein 1; tandem tudor domains, cell cycle-transcription complex; 1.25A {Homo sapiens} SCOP: b.34.9.1 b.34.9.1 PDB: 2ig0_A* 3lgf_A* 3lgl_A* 3lh0_A* 1xni_A Back     alignment and structure
>3db3_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, tandem tudor domains, LI metal binding, DNA replication; HET: M3L; 2.40A {Homo sapiens} PDB: 3db4_A 2l3r_A* Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>3m9q_A Protein MALE-specific lethal-3; chromodomain, MSL3, methyllysine recognition, aromatic CAGE, complex, transcription upregulation; 1.29A {Drosophila melanogaster} SCOP: b.34.13.0 Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Back     alignment and structure
>4eqp_A Thermonuclease; staphylococcal nuclease, hyperstable, PDTP, ionizable group, hydrolase; HET: THP; 1.35A {Staphylococcus aureus} PDB: 3ero_A* 2rbm_A* 3d8g_A* 3bdc_A* 4f8m_A* 3lx0_A* 3nqt_A* 3nk9_A* 3pmf_A* 3sr1_A* 3t13_A* 3mxp_A* 3r3o_A* 4df7_A* 3np8_A* 3nxw_A* 3oso_A* 3mz5_A* 3mhb_A* 3dhq_A* ... Back     alignment and structure
>1ssf_A Transformation related protein 53 binding protein 1; tudor domains, tandem, SH3-like fold, beta barrel, alpha- helix, cell cycle; NMR {Mus musculus} SCOP: b.34.9.1 b.34.9.1 Back     alignment and structure
>2xdp_A Lysine-specific demethylase 4C; oxidoreductase, histone modification; 1.56A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 80
d2diqa197 b.34.9.1 (A:8-104) Tudor and KH domain-containing 1e-17
d2hqxa190 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human ( 7e-12
d2d9ta160 b.34.9.1 (A:8-67) Tudor domain-containing protein 1e-09
d1mhna_59 b.34.9.1 (A:) Survival motor neuron protein 1, smn 6e-06
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Tudor/PWWP/MBT
family: Tudor domain
domain: Tudor and KH domain-containing protein TDRKH
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 68.8 bits (168), Expect = 1e-17
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (1%)

Query: 2  GGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANI 59
          G W+RA++L     N +  + FVD+G         LR +R+DFLSLPFQAIEC LA I
Sbjct: 40 GSWYRARVLGTLE-NGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARI 96


>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 60 Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
d2diqa197 Tudor and KH domain-containing protein TDRKH {Huma 99.9
d2hqxa190 P100 co-activator, SND1 {Human (Homo sapiens) [Tax 99.82
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 99.72
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 99.7
d2buda188 Putative histone acetyltransferase MOF {Fruit fly 96.63
d1wgsa_133 Probable histone acetyltransferase MYST1 {Mouse (M 95.67
d2qqra159 Jumonji domain-containing protein 2A {Human (Homo 93.86
d2qqra256 Jumonji domain-containing protein 2A {Human (Homo 91.09
d2diga155 Lamin-b receptor {Human (Homo sapiens) [TaxId: 960 85.88
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Tudor/PWWP/MBT
family: Tudor domain
domain: Tudor and KH domain-containing protein TDRKH
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=3.6e-25  Score=127.71  Aligned_cols=58  Identities=48%  Similarity=0.834  Sum_probs=54.9

Q ss_pred             CCcEEEEEEEEEecCCCEEEEEEeeeCCeEEEccccccccchhhcCCCcceeEEEecce
Q psy13437          1 MGGWFRAQILAVDVVNASCQVKFVDYGGYLTLETSALRQIRADFLSLPFQAIECGLANI   59 (80)
Q Consensus         1 D~~wyRa~I~~~~~~~~~~~V~~vDyG~~~~v~~~~lr~l~~~f~~lP~qA~~c~L~~v   59 (80)
                      ||.||||+|+++.. ++.+.|+|||||+++.|+.++||.|+++|..+|+||++|+|+||
T Consensus        39 d~~wyRa~V~~~~~-~~~~~V~~vDyG~~~~v~~~~l~~l~~~~~~lP~~A~~c~L~~v   96 (97)
T d2diqa1          39 NGSWYRARVLGTLE-NGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARI   96 (97)
T ss_dssp             TCSCEEEEECCCCS-SSCEEEEETTTCCEEEECGGGCEECCHHHHSSCCSSCCSCSSCS
T ss_pred             CCeEEEEEEEEECC-CCEEEEEEEeeCCEEEEeHHHhhccCHHHhhCChhhEEEEECcC
Confidence            78999999999875 46799999999999999999999999999999999999999997



>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qqra1 b.34.9.1 (A:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qqra2 b.34.9.1 (A:956-1011) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diga1 b.34.9.1 (A:8-62) Lamin-b receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure