Diaphorina citri psyllid: psy13438


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MLTLFQKSMIIEIELFHPTIFTSGICIGVWKSWEKEGLDIKDIVWPGNSHTPPQGVPEKFHLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKIDVAMAHHNESFYQCCSGFCIDLLGKFAEELGFTYELVRVEDGKWGTQEDL
ccEEEEEcEEEEEECcccCEEEEcEEEEEEEEEEEEEEEEccCCccccccccccccccccCEEEEEEccccEEEEcccccccccccccccCCccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHccEEEEEEEccccccccccc
**TLFQKSMIIEIELFHPTIFTSGICIGVWKSWEKEGLDIKDIVWPGNSHT***GVPEKFHLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKIDVAMAHHNESFYQCCSGFCIDLLGKFAEELGFTYELVRVEDGKWGT****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTLFQKSMIIEIELFHPTIFTSGICIGVWKSWEKEGLDIKDIVWPGNSHTPPQGVPEKFHLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKIDVAMAHHNESFYQCCSGFCIDLLGKFAEELGFTYELVRVEDGKWGTQEDL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035235 [BP]ionotropic glutamate receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007215, GO:0050789, GO:0044699
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0050975 [BP]sensory perception of touchprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005261 [MF]cation channel activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0005216, GO:0008324, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022803, GO:0022838
GO:0016594 [MF]glycine bindingprobableGO:0043168, GO:0043169, GO:0031406, GO:0043167, GO:0003674, GO:0005488, GO:0016597
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0042165 [MF]neurotransmitter bindingprobableGO:0003674, GO:0005488
GO:0045471 [BP]response to ethanolprobableGO:1901700, GO:0050896, GO:0008150, GO:0042221, GO:0097305, GO:0010033
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0043195 [CC]terminal boutonprobableGO:0044306, GO:0043679, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0044456, GO:0045202, GO:0043005, GO:0033267, GO:0042995
GO:0043197 [CC]dendritic spineprobableGO:0044309, GO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0048511 [BP]rhythmic processprobableGO:0008150
GO:0042391 [BP]regulation of membrane potentialprobableGO:0019725, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0051179 [BP]localizationprobableGO:0008150
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0017146 [CC]N-methyl-D-aspartate selective glutamate receptor complexprobableGO:0043234, GO:0043235, GO:0032991, GO:0008328, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0004970 [MF]ionotropic glutamate receptor activityprobableGO:0022891, GO:0022892, GO:0038023, GO:0005215, GO:0005230, GO:0022857, GO:0008066, GO:0015276, GO:0015075, GO:0060089, GO:0004888, GO:0015267, GO:0003674, GO:0004872, GO:0004871, GO:0022834, GO:0022803, GO:0022839, GO:0022838, GO:0005216, GO:0022836
GO:0072375 [BP]medium-term memoryprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007613, GO:0007610, GO:0007611, GO:0008150, GO:0050877, GO:0044699, GO:0003008

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PB7, chain A
Confidence level:very confident
Coverage over the Query: 60-97,113-152
View the alignment between query and template
View the model in PyMOL
Template: 3KG2, chain A
Confidence level:very confident
Coverage over the Query: 8-80,100-152
View the alignment between query and template
View the model in PyMOL