Psyllid ID: psy13438

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MLTLFQKSMIIEIELFHPTIFTSGICIGVWKSWEKEGLDIKDIVWPGNSHTPPQGVPEKFHLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKIDVAMAHHNESFYQCCSGFCIDLLGKFAEELGFTYELVRVEDGKWGTQEDL
ccEEEEEcEEEEEEEcccEEEEEcEEEEEEEEEEEEEEEEccEEccccccccccccccccEEEEEEEccccEEEEcccccccccccccccEEccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHccEEEEEEEccccccccccc
ccccccccEEEEEEcccccEEEEEEEccEEEEccccEEEEEEcccccccccccccccccccEEEEEEEcccEEEEEcccccccccccccccccccccccccccccccccccccccHHccccHHHHHHHHHHHHcccEEEEEEEEcccccEEEcc
MLTLFQKSMIIEIElfhptiftsgICIGVWKSwekegldikdivwpgnshtppqgvpekfhLKITfleeapyiqmsppdpvtgkcnmnrgvicrvagdadmDKIDVAMAHhnesfyqcCSGFCIDLLGKFAEELGFTYELVrvedgkwgtqedl
MLTLFQKSMIIEIELFHPTIFTSGICIGVWKSWEKEGLDIKDIVWPGNSHTPPQGVPEKFHLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKIDVAMAHHNESFYQCCSGFCIDLLGKFAEELGFTYELvrvedgkwgtqedl
MLTLFQKSMIIEIELFHPTIFTSGICIGVWKSWEKEGLDIKDIVWPGNSHTPPQGVPEKFHLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKIDVAMAHHNESFYQCCSGFCIDLLGKFAEELGFTYELVRVEDGKWGTQEDL
***LFQKSMIIEIELFHPTIFTSGICIGVWKSWEKEGLDIKDIVWPGNSHT***GVPEKFHLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKIDVAMAHHNESFYQCCSGFCIDLLGKFAEELGFTYELVRVEDGKW******
**T*F**SMIIEIELFHPTIFTSGICIGVWKSWEKEGLDIKDIVW***************HLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKIDVAMAHHNESFYQCCSGFCIDLLGKFAEELGFTYELVRVEDGKWGT****
MLTLFQKSMIIEIELFHPTIFTSGICIGVWKSWEKEGLDIKDIVWPGNSHTPPQGVPEKFHLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKIDVAMAHHNESFYQCCSGFCIDLLGKFAEELGFTYELVRVEDGKWGTQEDL
*LTLFQKSMIIEIELFHPTIFTSGICIGVWKSWEKEGLDIKDIVWPGNSHTPPQGVPEKFHLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGD***********HHNESFYQCCSGFCIDLLGKFAEELGFTYELVRVEDGKWGT*ED*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTLFQKSMIIEIELFHPTIFTSGICIGVWKSWEKEGLDIKDIVWPGNSHTPPQGVPEKFHLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKIDVAMAHHNESFYQCCSGFCIDLLGKFAEELGFTYELVRVEDGKWGTQEDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query154 2.2.26 [Sep-21-2011]
O15399 1336 Glutamate receptor ionotr yes N/A 0.753 0.086 0.327 7e-13
Q03391 1323 Glutamate receptor ionotr yes N/A 0.753 0.087 0.327 8e-13
Q62645 1323 Glutamate receptor ionotr yes N/A 0.753 0.087 0.327 9e-13
Q14957 1233 Glutamate receptor ionotr no N/A 0.727 0.090 0.386 1e-12
Q01098 1239 Glutamate receptor ionotr no N/A 0.727 0.090 0.369 3e-12
Q00961 1237 Glutamate receptor ionotr no N/A 0.727 0.090 0.369 5e-12
Q5R1P3 1485 Glutamate receptor ionotr no N/A 0.694 0.072 0.357 1e-11
P35436 1464 Glutamate receptor ionotr no N/A 0.720 0.075 0.352 1e-11
Q00959 1464 Glutamate receptor ionotr no N/A 0.720 0.075 0.352 1e-11
Q00960 1482 Glutamate receptor ionotr no N/A 0.694 0.072 0.357 1e-11
>sp|O15399|NMDE4_HUMAN Glutamate receptor ionotropic, NMDA 2D OS=Homo sapiens GN=GRIN2D PE=2 SV=2 Back     alignment and function desciption
 Score = 72.8 bits (177), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 40/122 (32%), Positives = 64/122 (52%), Gaps = 6/122 (4%)

Query: 32  SWEKEGLDIKDIVWPGNSHTPPQGVPEKFHLKITFLEEAPYIQMSPPDPVTGKCNMNRGV 91
           SWE++ L +K  +W        Q V +  HL +  LEE P++ + P DP++G C +   V
Sbjct: 403 SWEQQTLRLKYPLWSRYGRFL-QPVDDTQHLTVATLEERPFVIVEPADPISGTC-IRDSV 460

Query: 92  ICRVAGDADMDKIDVAMAHHNESFYQCCSGFCIDLLGKFAEELGFTYELVRVEDGKWGTQ 151
            CR    + +++             +CC GFCID+L + A  +GF+Y+L  V +GK G +
Sbjct: 461 PCR----SQLNRTHSPPPDAPRPEKRCCKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKK 516

Query: 152 ED 153
            D
Sbjct: 517 ID 518
NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine.
Homo sapiens (taxid: 9606)
>sp|Q03391|NMDE4_MOUSE Glutamate receptor ionotropic, NMDA 2D OS=Mus musculus GN=Grin2d PE=1 SV=3 Back     alignment and function description
>sp|Q62645|NMDE4_RAT Glutamate receptor ionotropic, NMDA 2D OS=Rattus norvegicus GN=Grin2d PE=1 SV=2 Back     alignment and function description
>sp|Q14957|NMDE3_HUMAN Glutamate receptor ionotropic, NMDA 2C OS=Homo sapiens GN=GRIN2C PE=2 SV=3 Back     alignment and function description
>sp|Q01098|NMDE3_MOUSE Glutamate receptor ionotropic, NMDA 2C OS=Mus musculus GN=Grin2c PE=2 SV=2 Back     alignment and function description
>sp|Q00961|NMDE3_RAT Glutamate receptor ionotropic, NMDA 2C OS=Rattus norvegicus GN=Grin2c PE=1 SV=1 Back     alignment and function description
>sp|Q5R1P3|NMDE2_CANFA Glutamate receptor ionotropic, NMDA 2B OS=Canis familiaris GN=GRIN2B PE=2 SV=1 Back     alignment and function description
>sp|P35436|NMDE1_MOUSE Glutamate receptor ionotropic, NMDA 2A OS=Mus musculus GN=Grin2a PE=1 SV=2 Back     alignment and function description
>sp|Q00959|NMDE1_RAT Glutamate receptor ionotropic, NMDA 2A OS=Rattus norvegicus GN=Grin2a PE=1 SV=2 Back     alignment and function description
>sp|Q00960|NMDE2_RAT Glutamate receptor ionotropic, NMDA 2B OS=Rattus norvegicus GN=Grin2b PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
312377227 1614 hypothetical protein AND_11537 [Anophele 0.954 0.091 0.7 9e-62
270004449 1000 hypothetical protein TcasGA2_TC003802 [T 0.824 0.127 0.811 2e-61
189235687 962 PREDICTED: similar to glutamate receptor 0.824 0.132 0.811 2e-61
198470904 1105 GA13251 [Drosophila pseudoobscura pseudo 0.824 0.114 0.804 3e-60
195469758 1089 GE16522 [Drosophila yakuba] gi|194187327 0.824 0.116 0.804 3e-60
195457349 1087 GK14575 [Drosophila willistoni] gi|19417 0.824 0.116 0.804 3e-60
194763914 1089 GF21362 [Drosophila ananassae] gi|190619 0.824 0.116 0.804 3e-60
158293107 935 Anopheles gambiae str. PEST AGAP012429-P 0.954 0.157 0.7 7e-59
157117890 1051 glutamate receptor, ionotropic, n-methyl 0.928 0.136 0.705 3e-58
340716966 1122 PREDICTED: glutamate [NMDA] receptor sub 0.824 0.113 0.803 3e-58
>gi|312377227|gb|EFR24111.1| hypothetical protein AND_11537 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  241 bits (614), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 105/150 (70%), Positives = 123/150 (82%), Gaps = 3/150 (2%)

Query: 7    KSMIIEIELFHPTIFTSGIC---IGVWKSWEKEGLDIKDIVWPGNSHTPPQGVPEKFHLK 63
            KS  ++I    P++ + G+    IGVWKSW+++ LDI+DI WPGNSHTPPQGVPEKFHLK
Sbjct: 1441 KSAELKIMNLRPSVNSKGLVWEEIGVWKSWQQQKLDIRDIAWPGNSHTPPQGVPEKFHLK 1500

Query: 64   ITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKIDVAMAHHNESFYQCCSGFC 123
            ITFLEEAPYI +SP DP++GKC M+RGV+CRVA D +M  ID+  AH N SFYQCCSGFC
Sbjct: 1501 ITFLEEAPYINLSPADPISGKCLMDRGVLCRVAADHEMTDIDMGQAHKNGSFYQCCSGFC 1560

Query: 124  IDLLGKFAEELGFTYELVRVEDGKWGTQED 153
            IDLL KFAEELGFTYELVRVEDGKWGT E+
Sbjct: 1561 IDLLEKFAEELGFTYELVRVEDGKWGTLEN 1590

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270004449|gb|EFA00897.1| hypothetical protein TcasGA2_TC003802 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189235687|ref|XP_971730.2| PREDICTED: similar to glutamate receptor, ionotropic, n-methyl d-aspartate epsilon (nmda epsilon) [Tribolium castaneum] Back     alignment and taxonomy information
>gi|198470904|ref|XP_001355429.2| GA13251 [Drosophila pseudoobscura pseudoobscura] gi|198145675|gb|EAL32487.2| GA13251 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195469758|ref|XP_002099803.1| GE16522 [Drosophila yakuba] gi|194187327|gb|EDX00911.1| GE16522 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195457349|ref|XP_002075535.1| GK14575 [Drosophila willistoni] gi|194171620|gb|EDW86521.1| GK14575 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|194763914|ref|XP_001964077.1| GF21362 [Drosophila ananassae] gi|190619002|gb|EDV34526.1| GF21362 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|158293107|ref|XP_314428.4| Anopheles gambiae str. PEST AGAP012429-PA [Anopheles gambiae str. PEST] gi|157016876|gb|EAA44457.4| AGAP012429-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157117890|ref|XP_001653086.1| glutamate receptor, ionotropic, n-methyl d-aspartate epsilon (nmda epsilon) [Aedes aegypti] gi|108875927|gb|EAT40152.1| AAEL008090-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|340716966|ref|XP_003396961.1| PREDICTED: glutamate [NMDA] receptor subunit epsilon-2-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
FB|FBgn0053513 1083 Nmdar2 "NMDA receptor 2" [Dros 0.824 0.117 0.804 3.5e-54
WB|WBGene00003775 990 nmr-2 [Caenorhabditis elegans 0.779 0.121 0.434 1.5e-24
UNIPROTKB|F1NAK2 1437 GRIN2A "Uncharacterized protei 0.733 0.078 0.362 1.4e-12
UNIPROTKB|F1NMB0 1370 GRIN2B "Uncharacterized protei 0.740 0.083 0.373 1.6e-12
UNIPROTKB|F1MR40 993 F1MR40 "Uncharacterized protei 0.753 0.116 0.327 1.8e-12
UNIPROTKB|F1P6H3 1126 GRIN2D "Uncharacterized protei 0.753 0.103 0.327 2.1e-12
UNIPROTKB|F1RL86 1328 GRIN2D "Uncharacterized protei 0.753 0.087 0.327 2.6e-12
MGI|MGI:95823 1323 Grin2d "glutamate receptor, io 0.753 0.087 0.327 4.2e-12
RGD|2740 1323 Grin2d "glutamate receptor, io 0.753 0.087 0.327 4.2e-12
UNIPROTKB|Q62645 1323 Grin2d "Glutamate receptor ion 0.753 0.087 0.327 4.2e-12
FB|FBgn0053513 Nmdar2 "NMDA receptor 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 569 (205.4 bits), Expect = 3.5e-54, P = 3.5e-54
 Identities = 103/128 (80%), Positives = 111/128 (86%)

Query:    27 IGVWKSWEKEGLDIKDIVWPGNSHTPPQGVPEKFHLKITFLEEAPYIQMSPPDPVTGKCN 86
             IGVWKSWE + LDI+DI WPGNSH PPQGVPEKFHLKITFLEEAPYI +SP DPV+GKC 
Sbjct:   470 IGVWKSWETQKLDIRDIAWPGNSHAPPQGVPEKFHLKITFLEEAPYINLSPADPVSGKCL 529

Query:    87 MNRGVICRVAGDADMDK-IDVAMAHHNESFYQCCSGFCIDLLGKFAEELGFTYELVRVED 145
             M+RGV+CRVA D +M   IDV  AH NESFYQCCSGFCIDLL KFAEELGFTYELVRVED
Sbjct:   530 MDRGVLCRVAADHEMAADIDVGQAHRNESFYQCCSGFCIDLLEKFAEELGFTYELVRVED 589

Query:   146 GKWGTQED 153
             GKWGT E+
Sbjct:   590 GKWGTLEN 597
GO:0004972 "N-methyl-D-aspartate selective glutamate receptor activity" evidence=ISS;IDA
GO:0006811 "ion transport" evidence=IEA
GO:0030288 "outer membrane-bounded periplasmic space" evidence=IEA
GO:0005234 "extracellular-glutamate-gated ion channel activity" evidence=IEA
GO:0035235 "ionotropic glutamate receptor signaling pathway" evidence=IDA
GO:0008328 "ionotropic glutamate receptor complex" evidence=IPI
GO:0016021 "integral to membrane" evidence=IDA
GO:0072375 "medium-term memory" evidence=IMP
GO:0007616 "long-term memory" evidence=IGI;IMP
GO:0050975 "sensory perception of touch" evidence=IMP
WB|WBGene00003775 nmr-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAK2 GRIN2A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMB0 GRIN2B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MR40 F1MR40 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6H3 GRIN2D "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RL86 GRIN2D "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:95823 Grin2d "glutamate receptor, ionotropic, NMDA2D (epsilon 4)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2740 Grin2d "glutamate receptor, ionotropic, N-methyl D-aspartate 2D" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q62645 Grin2d "Glutamate receptor ionotropic, NMDA 2D" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
pfam1061365 pfam10613, Lig_chan-Glu_bd, Ligated ion channel L- 1e-10
smart0091862 smart00918, Lig_chan-Glu_bd, Ligated ion channel L 2e-10
>gnl|CDD|204533 pfam10613, Lig_chan-Glu_bd, Ligated ion channel L-glutamate- and glycine-binding site Back     alignment and domain information 
 Score = 53.8 bits (130), Expect = 1e-10
 Identities = 17/36 (47%), Positives = 25/36 (69%)

Query: 118 CCSGFCIDLLGKFAEELGFTYELVRVEDGKWGTQED 153
              G+CIDLL + A+ LGF YE+  V DGK+G+++ 
Sbjct: 17  RFEGYCIDLLDELAKILGFNYEIYLVPDGKYGSEDK 52

This region, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and it binds L-glutamate and glycine. It is found in association with Lig_chan, pfam00060. Length = 65
>gnl|CDD|214911 smart00918, Lig_chan-Glu_bd, Ligated ion channel L-glutamate- and glycine-binding site Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 154
KOG1053|consensus 1258 99.94
KOG4440|consensus 993 99.86
PF1061365 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- 99.69
KOG1054|consensus 897 99.64
KOG1052|consensus 656 99.22
PRK15007 243 putative ABC transporter arginine-biding protein; 95.67
PF00497 225 SBP_bac_3: Bacterial extracellular solute-binding 95.63
TIGR01096 250 3A0103s03R lysine-arginine-ornithine-binding perip 95.17
PRK15010 260 ABC transporter lysine/arginine/ornithine binding 95.12
PRK15437 259 histidine ABC transporter substrate-binding protei 94.85
PRK09495 247 glnH glutamine ABC transporter periplasmic protein 93.71
TIGR02995 275 ectoine_ehuB ectoine/hydroxyectoine ABC transporte 93.09
PRK10859 482 membrane-bound lytic transglycosylase F; Provision 92.72
PRK11260 266 cystine transporter subunit; Provisional 92.43
PRK10797 302 glutamate and aspartate transporter subunit; Provi 91.46
smart00062 219 PBPb Bacterial periplasmic substrate-binding prote 91.26
TIGR03871 232 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associa 91.21
TIGR03870 246 ABC_MoxJ methanol oxidation system protein MoxJ. T 90.43
PRK09959 1197 hybrid sensory histidine kinase in two-component r 89.73
TIGR02285 268 conserved hypothetical protein. Members of this fa 87.08
PRK11917 259 bifunctional adhesin/ABC transporter aspartate/glu 86.4
PRK09959 1197 hybrid sensory histidine kinase in two-component r 84.06
>KOG1053|consensus Back     alignment and domain information 
Probab=99.94  E-value=2.8e-27  Score=218.45  Aligned_cols=119  Identities=36%  Similarity=0.707  Sum_probs=100.1

Q ss_pred             EEEEEcCcCCCceeEeeecCCCCCCCCCCCCCCCceEEEEeeccCCeEEEcCCCCCCCcccCcCceeeeecCCCCcchhh
Q psy13438         26 CIGVWKSWEKEGLDIKDIVWPGNSHTPPQGVPEKFHLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKID  105 (154)
Q Consensus        26 ~vG~W~~~~~~~L~~~~~~wpg~~~~~p~~~~~~~~LrVvTi~e~PfV~~~~~~~~~g~C~~~~~v~c~~~~~~~~~~~~  105 (154)
                      +||.|.   ++.|.|++.+||.... .+++.+.+.||+|+|++|+|||++++.||.+++|++ ++++|.++.+..+.   
T Consensus       381 ~VG~We---~~~L~M~y~vWPr~~~-~~q~~~d~~HL~VvTLeE~PFVive~vDP~t~~C~~-ntvpc~s~~~~t~s---  452 (1258)
T KOG1053|consen  381 RVGSWE---NGTLVMKYPVWPRYHK-FLQPVPDKLHLTVVTLEERPFVIVEDVDPLTQTCVR-NTVPCRSQLNSTFS---  452 (1258)
T ss_pred             eeceec---CCeEEEeccccccccC-ccCCCCCcceeEEEEeccCCeEEEecCCCCcCcCCC-CCCcchhhhhhccC---
Confidence            788885   5899999999996654 467777888999999999999999999999999997 59999976543322   


Q ss_pred             hhhccCCCccccccccchHHHHHHHHHHhCCeEEEEEecCCCCCCcCC
Q psy13438        106 VAMAHHNESFYQCCSGFCIDLLGKFAEELGFTYELVRVEDGKWGTQED  153 (154)
Q Consensus       106 ~~~~~gn~~~~~Cc~G~cIDLL~~La~~l~F~Yel~lv~DGkyGs~~~  153 (154)
                       ....+|.+.++||+|||||||++||++++|+|+||+|.|||||++.+
T Consensus       453 -s~~~~~~tvKkCCkGfCIDiLkKlA~~v~FtYDLYlVtnGKhGkk~n  499 (1258)
T KOG1053|consen  453 -SGDEANRTVKKCCKGFCIDILKKLARDVKFTYDLYLVTNGKHGKKIN  499 (1258)
T ss_pred             -CCccCCchHHhhhhhhhHHHHHHHHhhcCcceEEEEecCCcccceec
Confidence             11134556699999999999999999999999999999999998754

>KOG4440|consensus Back     alignment and domain information
>PF10613 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- and glycine-binding site; InterPro: IPR019594 This entry, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and binds L-glutamate and glycine [, ] Back     alignment and domain information
>KOG1054|consensus Back     alignment and domain information
>KOG1052|consensus Back     alignment and domain information
>PRK15007 putative ABC transporter arginine-biding protein; Provisional Back     alignment and domain information
>PF00497 SBP_bac_3: Bacterial extracellular solute-binding proteins, family 3; InterPro: IPR001638 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>PRK15010 ABC transporter lysine/arginine/ornithine binding periplasmic protein; Provisional Back     alignment and domain information
>PRK15437 histidine ABC transporter substrate-binding protein HisJ; Provisional Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein Back     alignment and domain information
>PRK10859 membrane-bound lytic transglycosylase F; Provisional Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>TIGR03871 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein Back     alignment and domain information
>TIGR03870 ABC_MoxJ methanol oxidation system protein MoxJ Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>TIGR02285 conserved hypothetical protein Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
3oek_A 286 Crystal Structure Of Glun2d Ligand-Binding Core In 1e-11
2a5s_A 284 Crystal Structure Of The Nr2a Ligand Binding Core I 2e-10
2rca_B 292 Crystal Structure Of The Nr3b Ligand Binding Core C 2e-08
1pb8_A 292 Crystal Structure Of The Nr1 Ligand Binding Core In 3e-08
1pb7_A 292 Crystal Structure Of The Nr1 Ligand Binding Core In 3e-08
2rc7_A 294 Crystal Structure Of The Nr3a Ligand Binding Core C 3e-08
3g3k_A 259 Crystal Structure Of The Glur6 Ligand Binding Domai 2e-06
3g3i_A 259 Crystal Structure Of The Glur6 Ligand Binding Domai 2e-06
3g3j_A 259 Crystal Structure Of The Glur6 Ligand Binding Domai 2e-06
1yae_A 312 Structure Of The Kainate Receptor Subunit Glur6 Ago 4e-06
2xxw_A 261 Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Di 4e-06
2xxr_A 261 Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lb 4e-06
2xxu_A 261 Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Di 4e-06
3g3g_A 259 Crystal Structure Of The Glur6 Ligand Binding Domai 4e-06
2i0c_A 259 Crystal Structure Of The Glur6 Ligand Binding Core 4e-06
1s50_A 259 X-Ray Structure Of The Glur6 Ligand Binding Core (S 4e-06
3g3h_A 259 Crystal Structure Of The Glur6 Ligand Binding Domai 4e-06
2i0b_A 259 Crystal Structure Of The Glur6 Ligand Binding Core 4e-06
3u92_A 257 Crystal Structure Of The Gluk3 Ligand Binding Domai 4e-06
3s9e_A 258 Crystal Structure Of The Kainate Receptor Gluk3 Lig 4e-06
3qxm_A 258 Crystal Structure Of Human Gluk2 Ligand-Binding Cor 5e-06
2anj_A 263 Crystal Structure Of The Glur2 Ligand Binding Core 4e-04
2zns_A 256 Crystal Structure Of The Ligand-Binding Core Of The 8e-04
2f34_A 258 Crystal Structure Of The Glur5 Ligand Binding Core 9e-04
1ycj_A 257 Crystal Structure Of The Kainate Receptor Glur5 Lig 9e-04
>pdb|3OEK|A Chain A, Crystal Structure Of Glun2d Ligand-Binding Core In Complex With L- Aspartate Length = 286 Back     alignment and structure 
Iteration: 1

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (54%), Gaps = 5/93 (5%)
Query: 61  HLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKIDVAMAHHNESFYQCCS 120
           HL +  LEE P++ + P DP++G C +   V CR    + +++             +CC 
Sbjct: 6   HLTVATLEERPFVIVEPADPISGTC-IRDSVPCR----SQLNRTHSPPPDAPRPEKRCCK 60
Query: 121 GFCIDLLGKFAEELGFTYELVRVEDGKWGTQED 153
           GFCID+L + A  +GF+Y+L  V +GK G + D
Sbjct: 61  GFCIDILKRLAHTIGFSYDLYLVTNGKHGKKID 93
>pdb|2A5S|A Chain A, Crystal Structure Of The Nr2a Ligand Binding Core In Complex With Glutamate Length = 284 Back     alignment and structure
>pdb|2RCA|B Chain B, Crystal Structure Of The Nr3b Ligand Binding Core Complex With Glycine At 1.58 Angstrom Resolution Length = 292 Back     alignment and structure
>pdb|1PB8|A Chain A, Crystal Structure Of The Nr1 Ligand Binding Core In Complex With D-Serine At 1.45 Angstroms Resolution Length = 292 Back     alignment and structure
>pdb|1PB7|A Chain A, Crystal Structure Of The Nr1 Ligand Binding Core In Complex With Glycine At 1.35 Angstroms Resolution Length = 292 Back     alignment and structure
>pdb|2RC7|A Chain A, Crystal Structure Of The Nr3a Ligand Binding Core Complex With Glycine At 1.58 Angstrom Resolution Length = 294 Back     alignment and structure
>pdb|3G3K|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k E757q Mutant With Glutamate And Nacl At 1.24 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3I|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e I749l Q753k Mutant With Glutamate And Nacl At 1.37 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3J|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k Mutant With Glutamate And Nacl At 1.32 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|1YAE|A Chain A, Structure Of The Kainate Receptor Subunit Glur6 Agonist Binding Domain Complexed With Domoic Acid Length = 312 Back     alignment and structure
>pdb|2XXW|A Chain A, Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXR|A Chain A, Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXU|A Chain A, Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|3G3G|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r Mutant With Glutamate And Nacl At 1.3 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|2I0C|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Dimer Crosslinked By Disulfide Bonds Between Y490c And L752c At 2.25 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|1S50|A Chain A, X-Ray Structure Of The Glur6 Ligand Binding Core (S1s2a) In Complex With Glutamate At 1.65 A Resolution Length = 259 Back     alignment and structure
>pdb|3G3H|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r I749l Q753k Mutant With Glutamate And Nacl At 1.5 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|2I0B|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Elkq Mutant Dimer At 1.96 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|3U92|A Chain A, Crystal Structure Of The Gluk3 Ligand Binding Domain Complex With Kainate And Zinc: P2221 Form Length = 257 Back     alignment and structure
>pdb|3S9E|A Chain A, Crystal Structure Of The Kainate Receptor Gluk3 Ligand Binding Domain In Complex With (S)-Glutamate Length = 258 Back     alignment and structure
>pdb|3QXM|A Chain A, Crystal Structure Of Human Gluk2 Ligand-Binding Core In Complex With Novel Marine-Derived Toxins, Neodysiherbaine A Length = 258 Back     alignment and structure
>pdb|2ANJ|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j- Y450w) Mutant In Complex With The Partial Agonist Kainic Acid At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|2ZNS|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human Ionotropic Glutamate Receptor, Glur5, In Complex With Glutamate Length = 256 Back     alignment and structure
>pdb|2F34|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer With Ubp310 At 1.74 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|1YCJ|A Chain A, Crystal Structure Of The Kainate Receptor Glur5 Ligand- Binding Core In Complex With (S)-Glutamate Length = 257 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
2a5s_A 284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 2e-21
2rc8_A 294 Glutamate [NMDA] receptor subunit 3A; membrane pro 6e-21
1pb7_A 292 N-methyl-D-aspartate receptor subunit 1; ligand bi 3e-16
1yae_A 312 Glutamate receptor, ionotropic kainate 2; kainate 4e-10
3g3k_A 259 Glutamate receptor, ionotropic kainate 2; membrane 6e-07
1mqi_A 263 Glutamate receptor 2; GLUR2, ligand binding core, 2e-06
2v3u_A 265 Glutamate receptor delta-2 subunit; postsynaptic m 5e-06
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 1e-04
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Length = 284 Back     alignment and structure
 Score = 86.6 bits (214), Expect = 2e-21
 Identities = 34/98 (34%), Positives = 50/98 (51%), Gaps = 7/98 (7%)

Query: 57  PEKFHLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKIDVAMAHHNESFY 116
           P+  HL I  LEEAP++ +   DP+T  C  N  V CR     +         +   +  
Sbjct: 2   PDDNHLSIVTLEEAPFVIVEDIDPLTETCVRN-TVPCRKFVKIN------NSTNEGMNVK 54

Query: 117 QCCSGFCIDLLGKFAEELGFTYELVRVEDGKWGTQEDL 154
           +CC GFCID+L K +  + FTY+L  V +GK G + + 
Sbjct: 55  KCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNN 92
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Length = 312 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Length = 259 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
2rc8_A 294 Glutamate [NMDA] receptor subunit 3A; membrane pro 99.45
1pb7_A 292 N-methyl-D-aspartate receptor subunit 1; ligand bi 99.42
2a5s_A 284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 99.32
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 99.21
3g3k_A 259 Glutamate receptor, ionotropic kainate 2; membrane 98.41
1yae_A 312 Glutamate receptor, ionotropic kainate 2; kainate 98.35
2v3u_A 265 Glutamate receptor delta-2 subunit; postsynaptic m 98.19
1mqi_A 263 Glutamate receptor 2; GLUR2, ligand binding core, 98.04
4gvo_A 243 LMO2349 protein; structural genomics, IDP05245, L- 96.65
3k4u_A 245 Binding component of ABC transporter; structural g 96.53
3i6v_A 232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 96.5
4h5g_A 243 Amino acid ABC superfamily ATP binding cassette tr 96.47
3kbr_A 239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 96.25
3mpk_A 267 Virulence sensor protein BVGS; venus flytrap, sens 96.22
3kzg_A 237 Arginine 3RD transport system periplasmic binding 96.19
3tql_A 227 Arginine-binding protein; transport and binding pr 96.17
3del_B 242 Arginine binding protein; alpha and beta protein ( 96.07
1ii5_A 233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 95.99
3hv1_A 268 Polar amino acid ABC uptake transporter substrate 95.97
4f3p_A 249 Glutamine-binding periplasmic protein; ssgcid, str 95.9
1lst_A 239 Lysine, arginine, ornithine-binding protein; amino 95.78
2pyy_A 228 Ionotropic glutamate receptor bacterial homologue; 95.68
4dz1_A 259 DALS D-alanine transporter; D-alanine binding, per 95.6
2q88_A 257 EHUB, putative ABC transporter amino acid-binding 95.59
3h7m_A 234 Sensor protein; histidine kinase sensor domain, ki 95.54
2y7i_A 229 STM4351; arginine-binding protein; HET: ARG; 1.90A 95.46
4eq9_A 246 ABC transporter substrate-binding protein-amino A 95.36
1wdn_A 226 GLNBP, glutamine binding protein; closed form, com 95.3
2iee_A 271 ORF2, probable ABC transporter extracellular-bindi 95.22
2pvu_A 272 ARTJ; basic amino acid binding protein, ABC transp 94.62
2yln_A 283 Putative ABC transporter, periplasmic binding Pro 93.15
3qax_A 268 Probable ABC transporter arginine-binding protein; 92.93
4i62_A 269 Amino acid ABC transporter, periplasmic amino ACI 91.43
2v25_A 259 Major cell-binding factor; antigen, adhesin, aspar 91.16
2vha_A 287 Periplasmic binding transport protein; periplasmic 90.72
1xt8_A 292 Putative amino-acid transporter periplasmic solut 90.38
2yjp_A 291 Putative ABC transporter, periplasmic binding Pro 88.24
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Back     alignment and structure
Probab=99.45  E-value=1.9e-13  Score=110.06  Aligned_cols=92  Identities=35%  Similarity=0.733  Sum_probs=68.8

Q ss_pred             CCceEEEEeeccCCeEEEcCCCCCCCcccCcCceeeeecCCCCcchhhhhh---ccCCCc----cccccccchHHHHHHH
Q psy13438         58 EKFHLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKIDVAM---AHHNES----FYQCCSGFCIDLLGKF  130 (154)
Q Consensus        58 ~~~~LrVvTi~e~PfV~~~~~~~~~g~C~~~~~v~c~~~~~~~~~~~~~~~---~~gn~~----~~~Cc~G~cIDLL~~L  130 (154)
                      .++||||+|++++||||+++.++ +|.|.  .+..|..+..+.-+.++..+   ...++.    +..++.||++||+++|
T Consensus         3 ~~~~l~v~t~~~~P~v~~~~~~~-~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~~~~~~~G~~vdll~~i   79 (294)
T 2rc8_A            3 NKLHLRVVTLIEHPFVFTREVDD-EGLCP--AGQLCLDPMTNDSSMLDRLFSSLHSSNDTVPIKFKKCCYGYCIDLLEQL   79 (294)
T ss_dssp             -CEEEEEEECCBTTTBEEECCCT-TSCCT--TSEEEECCCCCCHHHHHHHHHHHHSSSCCCCGGGEEEEESHHHHHHHHH
T ss_pred             CCCEEEEEEEeeCCcEEEecCCC-CCcCc--cCcccccccccccccchhhhhhcccCCCCCCccccCCceEEhHHHHHHH
Confidence            56899999999999999998775 79998  47889886654422111100   011222    1236799999999999


Q ss_pred             HHHhCCeEEEEEecCCCCCCcC
Q psy13438        131 AEELGFTYELVRVEDGKWGTQE  152 (154)
Q Consensus       131 a~~l~F~Yel~lv~DGkyGs~~  152 (154)
                      ++.+||+|+++.++||+||...
T Consensus        80 a~~lg~~~~~~~~~~~~~g~~~  101 (294)
T 2rc8_A           80 AEDMNFDFDLYIVGDGKYGAWK  101 (294)
T ss_dssp             HHHHTEEEEEEECTTCCCCCEE
T ss_pred             HHHcCCcEEEEECCCCcccccC
Confidence            9999999999999999999753
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Back     alignment and structure
>4gvo_A LMO2349 protein; structural genomics, IDP05245, L-cystine, ABC transporter, periplasmic binding protein, niaid; HET: HIS; 1.45A {Listeria monocytogenes} PDB: 2o1m_A Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} SCOP: c.94.1.0 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} SCOP: c.94.1.0 Back     alignment and structure
>4h5g_A Amino acid ABC superfamily ATP binding cassette transporter, binding protein; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: ARG; 1.78A {Streptococcus pneumoniae} PDB: 4h5f_A* Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} SCOP: c.94.1.0 Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} SCOP: c.94.1.0 Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} SCOP: c.94.1.0 Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} SCOP: c.94.1.0 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Back     alignment and structure
>4i62_A Amino acid ABC transporter, periplasmic amino ACI protein, putative; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases (NIAI niaid; HET: ARG; 1.05A {Streptococcus pneumoniae} Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 154
d2a5sa1 277 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate 4e-19
d1pb7a_ 289 c.94.1.1 (A:) N-methyl-D-aspartate receptor subuni 3e-13
d1mqia_ 260 c.94.1.1 (A:) Glutamate receptor ligand binding co 3e-05
d2f34a1 246 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor li 1e-04
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: N-methyl-D-aspartate receptor subunit 1
species: Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]

 Score = 79.3 bits (194), Expect = 4e-19
 Identities = 33/93 (35%), Positives = 48/93 (51%), Gaps = 7/93 (7%)

Query: 61  HLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKIDVAMAHHNESFYQCCS 120
           HL I  LEEAP++ +   DP+T  C  N  V CR     +         +   +  +CC 
Sbjct: 2   HLSIVTLEEAPFVIVEDIDPLTETCVRN-TVPCRKFVKIN------NSTNEGMNVKKCCK 54

Query: 121 GFCIDLLGKFAEELGFTYELVRVEDGKWGTQED 153
           GFCID+L K +  + FTY+L  V +GK G + +
Sbjct: 55  GFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVN 87
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 289 Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Length = 260 Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Length = 246 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
d2a5sa1 277 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.72
d1pb7a_ 289 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.28
d2f34a1 246 Glutamate receptor ligand binding core {Rat (Rattu 99.02
d1mqia_ 260 Glutamate receptor ligand binding core {Rat (Rattu 98.96
d1ii5a_ 226 Glutamate receptor ligand binding core {Synechocys 97.2
d1lsta_ 238 Lysine-,arginine-,ornithine-binding (LAO) protein 97.06
d1wdna_ 223 Glutamine-binding protein {Escherichia coli [TaxId 95.78
d1xt8a1 248 Putative amino-acid transporter CjaA {Campylobacte 93.76
d1fu3a_27 Conotoxin {Conus textile, Tx VIa [TaxId: 6494]} 81.2
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: N-methyl-D-aspartate receptor subunit 1
species: Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]

Probab=99.72  E-value=2.6e-18  Score=136.51  Aligned_cols=86  Identities=38%  Similarity=0.711  Sum_probs=68.8

Q ss_pred             ceEEEEeeccCCeEEEcCCCCCCCcccCcCceeeeecCCCCcchhhhhhccCCCccccccccchHHHHHHHHHHhCCeEE
Q psy13438         60 FHLKITFLEEAPYIQMSPPDPVTGKCNMNRGVICRVAGDADMDKIDVAMAHHNESFYQCCSGFCIDLLGKFAEELGFTYE  139 (154)
Q Consensus        60 ~~LrVvTi~e~PfV~~~~~~~~~g~C~~~~~v~c~~~~~~~~~~~~~~~~~gn~~~~~Cc~G~cIDLL~~La~~l~F~Ye  139 (154)
                      .||||+|++|+||||+++.+|.++.|..+ +++|+........      .......+.||+||||||+++||++|||+|+
T Consensus         1 ~hl~v~t~~~~Pfv~~~~~~~~~~~~~~~-~~~~~~~~~~~~~------~~~~~~~~~~~~G~~iDl~~~ia~~lg~~~e   73 (277)
T d2a5sa1           1 NHLSIVTLEEAPFVIVEDIDPLTETCVRN-TVPCRKFVKINNS------TNEGMNVKKCCKGFCIDILKKLSRTVKFTYD   73 (277)
T ss_dssp             CCEEEEECCBTTTBEEEECCCC-CCCCTT-CEEEEEEEESSSS------SSCEEEEEEEEESHHHHHHHHHHHHHTCCEE
T ss_pred             CceEEEEEecCCeEEEeccCcccCcccCC-CcccceecccccC------CCCCcccccceeeeHHHHHHHHHHHhCCCEE
Confidence            49999999999999999999999999974 7889875432210      0011123679999999999999999999999


Q ss_pred             EEEecCCCCCCcC
Q psy13438        140 LVRVEDGKWGTQE  152 (154)
Q Consensus       140 l~lv~DGkyGs~~  152 (154)
                      +++|+||+||+..
T Consensus        74 ~~~v~~~~~g~~~   86 (277)
T d2a5sa1          74 LYLVTNGKHGKKV   86 (277)
T ss_dssp             EEECCSSSSCCEE
T ss_pred             EEEccCCCcCccC
Confidence            9999999999754
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1fu3a_ g.3.6.1 (A:) Conotoxin {Conus textile, Tx VIa [TaxId: 6494]} Back     information, alignment and structure