Diaphorina citri psyllid: psy13474

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
MQELFSQLQSSHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAEDMCGAKHCIPHEKFAMTLVEQSVCGACGATSEPLPFTQEGK
cHHHHHHHHHccccccccHHHHHHHHHHcHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHccccccccccccccccccc
MQELFSQLQSSHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAEDMCGAKHCIPHEKFAMTLVEQSVCGACGA************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQELFSQLQSSHESALPPDALRRALAEAFFDQQRFQLGFMDDAAECFENMLLRIHYHIASEEAEDMCGAKHCIPHEKFAMTLVEQSVCGACGATSEPLPFTQEGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Inactive ubiquitin carboxyl-terminal hydrolase 54 Has no peptidase activity.confidentQ70EL1
Inactive ubiquitin carboxyl-terminal hydrolase 54 Has no peptidase activity.confidentQ8BL06
Inactive ubiquitin carboxyl-terminal hydrolase 54 Has no peptidase activity.confidentQ6IE24

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004221 [MF]ubiquitin thiolesterase activityprobableGO:0016787, GO:0003674, GO:0016790, GO:0016788, GO:0003824

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AYN, chain A
Confidence level:confident
Coverage over the Query: 1-95
View the alignment between query and template
View the model in PyMOL