Diaphorina citri psyllid: psy13477

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----

MSSMSSRSQMSRLEAFIVRLTNLSGVVVDFGSGGWWFESKSTVSLGHSLEKLQQVFQWRALDFEYPSEEIRQYAKFTKDFVPENNLPVGIEVWRNKLFVTVPRWEDGVPSTLNYIPLDAATSSSPNLIPYPSWEANQVPPQPQDQCDTLTTTYRIKADSCDRLWVLDSGTVGIGNTTKQICPYAIHVFDLKTDRRIRKYQFRPEDILPGTFIANIAVDTDRRIRKYQFRPEDILPGTFIANIAVDVGKNCEDTFLYASDELAYGLLSYSWEENTSWRASHGFFFPDPLLVPYKET

cccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEECccCCcccccccccEEEEEEEcCEECcccHHHHHHHHHccccccccccCEEEEEEccEEEEEEcccccccccEEEEEEcccccccccccccccccccccccccccccccccEEEEEEEEcccccEEEEEccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccEEEEcccccCEEEEcccccccccCEEEEEEEcccccccEEEEEEcccccEEEEEEccccCEEEEEcccccccccccccccc

************LEAFIVRLTNLSGVVVDFGSGGWWFESKSTVSLGHSLEKLQQVFQWRALDFEYPSEEIRQYAKFTKDFVPENNLPVGIEVWRNKLFVTVPRWEDGVPSTLNYIPLDAATSSSPNLIPYPSWEANQVPPQPQDQCDTLTTTYRIKADSCDRLWVLDSGTVGIGNTTKQICPYAIHVFDLKTDRRIRKYQFRPEDILPGTFIANIAVDTDRRIRKYQFRPEDILPGTFIANIAVDVGKNCEDTFLYASDELAYGLLSYSWEENTSWRASHGFFFPDPLLVPYK**

xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein yellow	Controls the pigmentation pattern of the adult cuticle and larval mouth parts.	confident	Q9BI18

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:1901362 [BP]	organic cyclic compound biosynthetic process	probable	GO:1901576, GO:0071704, GO:0009058, GO:0008150, GO:0008152, GO:1901360
GO:1901564 [BP]	organonitrogen compound metabolic process	probable	GO:0071704, GO:0006807, GO:0008150, GO:0008152
GO:0019438 [BP]	aromatic compound biosynthetic process	probable	GO:0009987, GO:0006725, GO:0044237, GO:0044249, GO:0009058, GO:0008150, GO:0008152
GO:0070451 [CC]	cell hair	probable	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005576 [CC]	extracellular region	probable	GO:0005575

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3Q6K, chain A
Confidence level:very confident
Coverage over the Query: 52-133,144-204,232-294
View the alignment between query and template
View the model in PyMOL

Template: 3SRE, chain A
Confidence level:probable
Coverage over the Query: 80-272
View the alignment between query and template
View the model in PyMOL