Psyllid ID: psy13477

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----
MSSMSSRSQMSRLEAFIVRLTNLSGVVVDFGSGGWWFESKSTVSLGHSLEKLQQVFQWRALDFEYPSEEIRQYAKFTKDFVPENNLPVGIEVWRNKLFVTVPRWEDGVPSTLNYIPLDAATSSSPNLIPYPSWEANQVPPQPQDQCDTLTTTYRIKADSCDRLWVLDSGTVGIGNTTKQICPYAIHVFDLKTDRRIRKYQFRPEDILPGTFIANIAVDTDRRIRKYQFRPEDILPGTFIANIAVDVGKNCEDTFLYASDELAYGLLSYSWEENTSWRASHGFFFPDPLLVPYKET
cccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccEEcccccccccEEEEEEEcEEEEcccHHHHHHHHHccccccccccEEEEEEEccEEEEEEcccccccccEEEEEEcccccccccccccccccccccccccccccccccEEEEEEEEcccccEEEEEccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccEEEEcccccEEEEEcccccccccEEEEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEEcccccccccccccccc
ccccccccHHHHHHEEEEHHHHEEEEEEEccccEEEEEcccccccHHHHHHccEEEEHHEcccccccHHHHHHHHHccccccccccccccEEcccEEEEEEcccccccccEEEEEEccccccccccccccccccHcccccccccccccEEEEEEEEEcccccEEEEEccEEccccccccccccEEEEEEcccccEEEEEEccHHHcccccEEEEEEEEcccccccEEEEEccccccccEEEEEEEcccccccEEEEEEcccccEEEEEEcccccEEEEEcccccccccccccccc
MSSMSSRSQMSRLEAFIVRLTNLSGvvvdfgsggwwfeskstvslGHSLEKLQQVFQWRaldfeypseEIRQYAKFTkdfvpennlpvgiEVWRNKLFvtvprwedgvpstlnyipldaatssspnlipypsweanqvppqpqdqcdtltTTYRikadscdrlwvldsgtvgignttkqicpyaihvfdlktdrrirkyqfrpedilpgtfiaNIAVdtdrrirkyqfrpedilpgtfIANIAVdvgkncedtflyaSDELAYGLLSYsweentswrashgfffpdpllvpyket
mssmssrsQMSRLEAFIVRLTNLSGVVVDFGSGGWWFESKSTVSLGHSLEKLQQVFQWRALDFEYPSEEIRQYAKFTKDFVPENNLPVGIEVWRNKLFVTVPRWEDGVPSTLNYIPLDAATSSSPNLIPYPSWEANQVPPQPQDQCDTLTTTYRIKADSCDRLWVLDSGTVgignttkqicpyaihvfdlktdrRIRKYqfrpedilpgtfianiavdtdRRIRKYqfrpedilpgtFIANIAVDVGKNCEDTFLYASDELAYGLLSYSWEENTSWRASHGfffpdpllvpyket
mssmssrsqmsrLEAFIVRLTNLSGVVVDFGSGGWWFESKSTVSLGHSLEKLQQVFQWRALDFEYPSEEIRQYAKFTKDFVPENNLPVGIEVWRNKLFVTVPRWEDGVPSTLNYIPLDAATSSSPNLIPYPSWEANQVPPQPQDQCDTLTTTYRIKADSCDRLWVLDSGTVGIGNTTKQICPYAIHVFDLKTDRRIRKYQFRPEDILPGTFIANIAVDTDRRIRKYQFRPEDILPGTFIANIAVDVGKNCEDTFLYASDELAYGLLSYSWEENTSWRASHGFFFPDPLLVPYKET
************LEAFIVRLTNLSGVVVDFGSGGWWFESKSTVSLGHSLEKLQQVFQWRALDFEYPSEEIRQYAKFTKDFVPENNLPVGIEVWRNKLFVTVPRWEDGVPSTLNYIPLDAA*******I*****************CDTLTTTYRIKADSCDRLWVLDSGTVGIGNTTKQICPYAIHVFDLKTDRRIRKYQFRPEDILPGTFIANIAVDTDRRIRKYQFRPEDILPGTFIANIAVDVGKNCEDTFLYASDELAYGLLSYSWEENTSWRASHGFFFPDPLLVP****
*************EAFIVRLTNLSGVVVDFGSGGWWFESKSTVSLGHSLEKLQQVFQWRALDFEYPSEEIRQYAKFTKDFVPENNLPVGIEVWRNKLFVTVPRWEDGVPSTLNYIPLDAATSSSPNLIPYPSWEANQVPPQPQDQCDTLTTTYRIKADSCDRLWVLDSGTVGIGNTTKQICPYAIHVFDLKTDRRIRKYQFRPEDILPGTFIANIAVDTDRRIRKYQFRPEDILPGTFIANIAVDVGKNCEDTFLYASDELAYGLLSYSWEENTSWRASHGFFFPDPLLVPYK**
**********SRLEAFIVRLTNLSGVVVDFGSGGWWFESKSTVSLGHSLEKLQQVFQWRALDFEYPSEEIRQYAKFTKDFVPENNLPVGIEVWRNKLFVTVPRWEDGVPSTLNYIPLDAATSSSPNLIPYPSWEANQVPPQPQDQCDTLTTTYRIKADSCDRLWVLDSGTVGIGNTTKQICPYAIHVFDLKTDRRIRKYQFRPEDILPGTFIANIAVDTDRRIRKYQFRPEDILPGTFIANIAVDVGKNCEDTFLYASDELAYGLLSYSWEENTSWRASHGFFFPDPLLVPYKET
*********MSRLEAFIVRLTNLSGVVVDFGSGGWWFESKSTVSLGHSLEKLQQVFQWRALDFEYPSEEIRQYAKFTKDFVPENNLPVGIEVWRNKLFVTVPRWEDGVPSTLNYIPLDAATSSSPNLIPYPSWEANQVPPQPQDQCDTLTTTYRIKADSCDRLWVLDSGTVGIGNTTKQICPYAIHVFDLKTDRRIRKYQFRPEDILPGTFIANIAVDTDRRIRKYQFRPEDILPGTFIANIAVDVGKNCEDTFLYASDELAYGLLSYSWEENTSWRASHGFFFPDPLLVPY***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSMSSRSQMSRLEAFIVRLTNLSGVVVDFGSGGWWFESKSTVSLGHSLEKLQQVFQWRALDFEYPSEEIRQYAKFTKDFVPENNLPVGIEVWRNKLFVTVPRWEDGVPSTLNYIPLDAATSSSPNLIPYPSWEANQVPPQPQDQCDTLTTTYRIKADSCDRLWVLDSGTVGIGNTTKQICPYAIHVFDLKTDRRIRKYQFRPEDILPGTFIANIAVDTDRRIRKYQFRPEDILPGTFIANIAVDVGKNCEDTFLYASDELAYGLLSYSWEENTSWRASHGFFFPDPLLVPYKET
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query295 2.2.26 [Sep-21-2011]
O02437 568 Protein yellow OS=Drosoph N/A N/A 0.735 0.382 0.497 7e-67
Q9GP71 568 Protein yellow OS=Drosoph N/A N/A 0.735 0.382 0.493 1e-66
Q9GP81 568 Protein yellow OS=Drosoph N/A N/A 0.701 0.364 0.510 2e-66
Q9BI18 560 Protein yellow OS=Drosoph yes N/A 0.701 0.369 0.502 3e-66
Q9BI17 541 Protein yellow OS=Drosoph N/A N/A 0.772 0.421 0.475 2e-65
P62407 541 Protein yellow OS=Drosoph N/A N/A 0.701 0.382 0.497 9e-65
P62408 541 Protein yellow OS=Drosoph N/A N/A 0.701 0.382 0.497 9e-65
P09957 541 Protein yellow OS=Drosoph yes N/A 0.701 0.382 0.497 1e-64
Q9BI23 541 Protein yellow OS=Drosoph N/A N/A 0.701 0.382 0.489 2e-64
O18330 432 Major royal jelly protein no N/A 0.715 0.488 0.312 4e-22
>sp|O02437|YELL_DROSU Protein yellow OS=Drosophila subobscura GN=y PE=3 SV=1 Back     alignment and function desciption
 Score =  254 bits (648), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 159/249 (63%), Gaps = 32/249 (12%)

Query: 41  STVSLGHSLEKLQQVFQWRALDFEYPSEEIRQYAKFTKDFVPENNLPVGIEVWRNKLFVT 100
           + VS   +  KLQ+ + W  LDF +PS  +++ A  + D++P N LPVG+E + N+LFVT
Sbjct: 21  AMVSPSQAAYKLQERYSWNQLDFAFPSARLKEQALASGDYIPTNALPVGVEHFGNRLFVT 80

Query: 101 VPRWEDGVPSTLNYIPLDAATSSSPNLIPYPSWEANQVPPQPQDQCDTLTTTYRIKADSC 160
           VPRW DG+P+TL YI +D + + SP LIPYP W AN       D  +++TT YRIK D C
Sbjct: 81  VPRWRDGIPATLTYINMDHSVTGSPELIPYPDWRANTA----GDCANSITTAYRIKVDEC 136

Query: 161 DRLWVLDSGTVGIGNTTKQICPYAIHVFDLKTDRRIRKYQFRPEDILPGTFIANIAVDTD 220
            RLWVLD+GTVGIGNTT   CPYAI++FDL TD RIR+Y+    D  P TFIA       
Sbjct: 137 GRLWVLDTGTVGIGNTTTNPCPYAINIFDLATDTRIRRYELPAADTNPNTFIA------- 189

Query: 221 RRIRKYQFRPEDILPGTFIANIAVDVGKNCEDTFLYASDELAYGLLSYSWEENTSWR-AS 279
                               NIAVD+GK+C+D F Y +DEL YGL+SYSWE N SWR ++
Sbjct: 190 --------------------NIAVDIGKSCDDAFAYFADELGYGLISYSWELNKSWRFSA 229

Query: 280 HGFFFPDPL 288
           H +FFPDPL
Sbjct: 230 HSYFFPDPL 238
Controls the pigmentation pattern of the adult cuticle and larval mouth parts.
Drosophila subobscura (taxid: 7241)
>sp|Q9GP71|YELL_DROMD Protein yellow OS=Drosophila madeirensis GN=y PE=3 SV=1 Back     alignment and function description
>sp|Q9GP81|YELL_DROGU Protein yellow OS=Drosophila guanche GN=y PE=3 SV=1 Back     alignment and function description
>sp|Q9BI18|YELL_DROPS Protein yellow OS=Drosophila pseudoobscura pseudoobscura GN=y PE=3 SV=2 Back     alignment and function description
>sp|Q9BI17|YELL_DROYA Protein yellow OS=Drosophila yakuba GN=y PE=3 SV=1 Back     alignment and function description
>sp|P62407|YELL_DROSI Protein yellow OS=Drosophila simulans GN=y PE=3 SV=1 Back     alignment and function description
>sp|P62408|YELL_DROMA Protein yellow OS=Drosophila mauritiana GN=y PE=3 SV=1 Back     alignment and function description
>sp|P09957|YELL_DROME Protein yellow OS=Drosophila melanogaster GN=y PE=1 SV=1 Back     alignment and function description
>sp|Q9BI23|YELL_DROER Protein yellow OS=Drosophila erecta GN=y PE=3 SV=1 Back     alignment and function description
>sp|O18330|MRJP1_APIME Major royal jelly protein 1 OS=Apis mellifera GN=MRJP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
288869481 423 yellow-y precursor [Acyrthosiphon pisum] 0.728 0.508 0.589 4e-79
270297224 412 yellow-y precursor [Tribolium castaneum] 0.698 0.5 0.579 3e-71
157114374 550 yellow protein precursor [Aedes aegypti] 0.701 0.376 0.550 4e-70
158296450 549 AGAP000879-PA [Anopheles gambiae str. PE 0.705 0.378 0.531 1e-69
294846073 526 yellow [Biston betularia] 0.728 0.408 0.520 9e-69
152002411 509 Yellow [Papilio xuthus] 0.728 0.422 0.536 6e-68
87248445 514 yellow protein [Bombyx mori] gi|22098368 0.725 0.416 0.532 3e-67
112984114 514 yellow-y precursor [Bombyx mori] gi|9321 0.725 0.416 0.532 3e-67
296040329 508 Yellow [Papilio machaon] 0.728 0.423 0.528 4e-67
307207745 430 Protein yellow [Harpegnathos saltator] 0.715 0.490 0.518 6e-67
>gi|288869481|ref|NP_001165848.1| yellow-y precursor [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  300 bits (769), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 145/246 (58%), Positives = 172/246 (69%), Gaps = 31/246 (12%)

Query: 48  SLEKLQQVFQWRALDFEYPSEEIRQYAKFTKDFVPENNLPVGIEVWRNKLFVTVPRWEDG 107
           +L+KL ++++W +LD+ + SEE + YA    +FVPENNLPVGIEVW+NKLFVTVPRW +G
Sbjct: 19  ALQKLTELYKWSSLDYTFSSEEHKNYALERGEFVPENNLPVGIEVWKNKLFVTVPRWSNG 78

Query: 108 VPSTLNYIPLDAATSSSPNLIPYPSWEANQVPPQPQDQCDTLTTTYRIKADSCDRLWVLD 167
           VPSTLNYIPLD +++ SP L PYP+W  N+     +  CD LTTTYR+KADSC+RLWVLD
Sbjct: 79  VPSTLNYIPLDVSSTQSPKLTPYPNWAYNR-----EGNCDGLTTTYRVKADSCNRLWVLD 133

Query: 168 SGTVGIGNTTKQICPYAIHVFDLKTDRRIRKYQFRPEDILPGTFIANIAVDTDRRIRKYQ 227
           SGTVGIGNTTKQ+CPYAIHVFDL TD+ +RKY  RPED    TFIANIA+D         
Sbjct: 134 SGTVGIGNTTKQVCPYAIHVFDLTTDKVLRKYTLRPEDTNDRTFIANIAIDIG------- 186

Query: 228 FRPEDILPGTFIANIAVDVGKNCEDTFLYASDELAYGLLSYSWEENTSWRASHGFFFPDP 287
                               K CEDTFLYASDEL YGL+SYSWE N SWR +H F  PDP
Sbjct: 187 -------------------SKGCEDTFLYASDELGYGLISYSWESNKSWRHTHSFLMPDP 227

Query: 288 LLVPYK 293
           L   Y 
Sbjct: 228 LAGDYN 233

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270297224|ref|NP_001161919.1| yellow-y precursor [Tribolium castaneum] gi|264666912|gb|ACY71063.1| yellow-y [Tribolium castaneum] gi|270001900|gb|EEZ98347.1| hypothetical protein TcasGA2_TC000802 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157114374|ref|XP_001658066.1| yellow protein precursor [Aedes aegypti] gi|108877328|gb|EAT41553.1| AAEL006830-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|158296450|ref|XP_316854.4| AGAP000879-PA [Anopheles gambiae str. PEST] gi|157015303|gb|EAA12085.4| AGAP000879-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|294846073|gb|ADF43215.1| yellow [Biston betularia] Back     alignment and taxonomy information
>gi|152002411|dbj|BAF73474.1| Yellow [Papilio xuthus] Back     alignment and taxonomy information
>gi|87248445|gb|ABD36275.1| yellow protein [Bombyx mori] gi|220983687|dbj|BAH11146.1| yellow protein [Bombyx mori] gi|379046456|gb|AFC87789.1| yellow protein [Bombyx mori] Back     alignment and taxonomy information
>gi|112984114|ref|NP_001037434.1| yellow-y precursor [Bombyx mori] gi|93211156|gb|ABC96700.2| yellow [Bombyx mori] Back     alignment and taxonomy information
>gi|296040329|dbj|BAJ07589.1| Yellow [Papilio machaon] Back     alignment and taxonomy information
>gi|307207745|gb|EFN85363.1| Protein yellow [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
FB|FBgn0004034 541 y "yellow" [Drosophila melanog 0.627 0.341 0.510 5.2e-49
FB|FBgn0041713 438 yellow-c "yellow-c" [Drosophil 0.779 0.525 0.374 8e-37
FB|FBgn0039896 463 yellow-h "yellow-h" [Drosophil 0.616 0.393 0.416 4e-35
FB|FBgn0032601 453 yellow-b "yellow-b" [Drosophil 0.566 0.368 0.377 1.2e-28
UNIPROTKB|O18330 432 MRJP1 "Major royal jelly prote 0.508 0.347 0.358 1.5e-25
FB|FBgn0041710 447 yellow-f "yellow-f" [Drosophil 0.681 0.449 0.336 1.8e-25
FB|FBgn0038151 426 yellow-e2 "yellow-e2" [Drosoph 0.477 0.330 0.333 1.8e-23
FB|FBgn0038105 452 yellow-f2 "yellow-f2" [Drosoph 0.637 0.415 0.315 8.1e-21
UNIPROTKB|Q8MZM5 462 dce "Dopachrome conversion enz 0.555 0.354 0.300 1.4e-19
FB|FBgn0041712 432 yellow-d "yellow-d" [Drosophil 0.535 0.365 0.316 1.5e-19
FB|FBgn0004034 y "yellow" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 511 (184.9 bits), Expect = 5.2e-49, P = 5.2e-49
 Identities = 97/190 (51%), Positives = 127/190 (66%)

Query:    30 FGSGGWWFESKST-VSLGHSLEKLQQVFQWRALDFEYPSEEIRQYAKFTKDFVPENNLPV 88
             F   GW   +  T V+   +  KLQ+ + W  LDF +P+  ++  A  + D++P+N LPV
Sbjct:     2 FQDKGWILVTLITLVTPSWAAYKLQERYSWSQLDFAFPNTRLKDQALASGDYIPQNALPV 61

Query:    89 GIEVWRNKLFVTVPRWEDGVPSTLNYIPLDAATSSSPNLIPYPSWEANQVPPQPQDQCDT 148
             G+E + N+LFVTVPRW DG+P+TL YI +D + + SP LIPYP W +N       D  ++
Sbjct:    62 GVEHFGNRLFVTVPRWRDGIPATLTYINMDRSLTGSPELIPYPDWRSNTAG----DCANS 117

Query:   149 LTTTYRIKADSCDRLWVLDSGTVGIGNTTKQICPYAIHVFDLKTDRRIRKYQFRPEDILP 208
             +TT YRIK D C RLWVLD+GTVGIGNTT   CPYA++VFDL TD RIR+Y+    D  P
Sbjct:   118 ITTAYRIKVDECGRLWVLDTGTVGIGNTTTNPCPYAVNVFDLTTDTRIRRYELPGVDTNP 177

Query:   209 GTFIANIAVD 218
              TFIANIAVD
Sbjct:   178 NTFIANIAVD 187
GO:0005576 "extracellular region" evidence=IDA
GO:0048066 "developmental pigmentation" evidence=IEP;IMP;TAS
GO:0005737 "cytoplasm" evidence=IDA
GO:0042438 "melanin biosynthetic process" evidence=IMP
GO:0048067 "cuticle pigmentation" evidence=IGI;IMP
GO:0048065 "male courtship behavior, veined wing extension" evidence=IMP
GO:0006583 "melanin biosynthetic process from tyrosine" evidence=TAS
GO:0060179 "male mating behavior" evidence=IMP
GO:0070451 "cell hair" evidence=IDA
GO:0048082 "regulation of adult chitin-containing cuticle pigmentation" evidence=IGI
GO:0016853 "isomerase activity" evidence=IBA
FB|FBgn0041713 yellow-c "yellow-c" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039896 yellow-h "yellow-h" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032601 yellow-b "yellow-b" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|O18330 MRJP1 "Major royal jelly protein 1" [Apis mellifera (taxid:7460)] Back     alignment and assigned GO terms
FB|FBgn0041710 yellow-f "yellow-f" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038151 yellow-e2 "yellow-e2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038105 yellow-f2 "yellow-f2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MZM5 dce "Dopachrome conversion enzyme" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
FB|FBgn0041712 yellow-d "yellow-d" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9BI18YELL_DROPSNo assigned EC number0.50200.70160.3696yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
pfam03022 285 pfam03022, MRJP, Major royal jelly protein 9e-38
>gnl|CDD|217322 pfam03022, MRJP, Major royal jelly protein Back     alignment and domain information 
 Score =  134 bits (340), Expect = 9e-38
 Identities = 50/144 (34%), Positives = 70/144 (48%), Gaps = 28/144 (19%)

Query: 150 TTTYRIKADSCDRLWVLDSGTVGIGNTTKQICPYAIHVFDLKTDRRIRKYQFRPEDILPG 209
            + YRI  D CDRLWVLDSG V      KQICP  + VFDL TD+ +++++  P D+   
Sbjct: 1   VSVYRIAVDECDRLWVLDSGIVNTLQPPKQICPPKLLVFDLATDKLLKRFEL-PADVA-- 57

Query: 210 TFIANIAVDTDRRIRKYQFRPEDILPGTFIANIAVDVGK-NCEDTFLYASDELAYGLLSY 268
                                      + + N+ VDVG   C+DTF+Y +D    GL+ Y
Sbjct: 58  ------------------------KGNSRLVNLVVDVGDDTCDDTFVYIADAKGRGLIVY 93

Query: 269 SWEENTSWRASHGFFFPDPLLVPY 292
              ++ SWR  H  F+PDP    +
Sbjct: 94  DLADDKSWRVEHNTFYPDPDFGKF 117

Royal jelly is the food of queen bee larvae, and is responsible for the high reproductive ability of the queen. Major royal jelly proteins make up around 90% of larval jelly proteins. This family also the sequence-related yellow protein of drosophila which controls pigmentation of the adult cuticle and larval mouth parts. Length = 285

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
3q6k_A 381 Salivary Protein From Lutzomyia Longipalpis Length 4e-06
3q6p_A 381 Salivary Protein From Lutzomyia Longipalpis. Seleno 5e-06
>pdb|3Q6K|A Chain A, Salivary Protein From Lutzomyia Longipalpis Length = 381 Back     alignment and structure 
Iteration: 1

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 75/199 (37%), Gaps = 47/199 (23%)
Query: 96  KLFVTVPRWEDGVPSTLNYI----PLDAATSSSPNLIPYPSWEANQVPPQPQDQCDTLTT 151
           KLF+ VPR    VP TL  +     L      SP L  +   +  +           LT+
Sbjct: 39  KLFLAVPRKLPRVPYTLAEVDTKNSLGVKGKHSPLLNKFSGHKTGK----------ELTS 88
Query: 152 TYRIKADSCDRLWVLDSGTVGIGNTTKQICPYAIHVFDLKTDRRIRKYQFRPEDILPGTF 211
            Y+   D C RLWV+D G+V                          +Y+ R     P   
Sbjct: 89  IYQPVIDDCRRLWVVDIGSV--------------------------EYRSRGAKDYPSHR 122
Query: 212 IANIAVDTDR----RIRKYQFRPEDILPGTFIANIAVDVGK---NCEDTFLYASDELAYG 264
            A +A D  +     + +Y F    +   T+    AVDV     +C +TF+Y ++ L   
Sbjct: 123 PAIVAYDLKQPNYPEVVRYYFPTRLVEKPTYFGGFAVDVANPKGDCSETFVYITNFLRGA 182
Query: 265 LLSYSWEENTSWRASHGFF 283
           L  Y  ++  SW  +H  F
Sbjct: 183 LFIYDHKKQDSWNVTHPTF 201
>pdb|3Q6P|A Chain A, Salivary Protein From Lutzomyia Longipalpis. Selenomethionine Derivative Length = 381 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
3q6k_A 381 43.2 kDa salivary protein; beta propeller, binding 3e-52
2qe8_A 343 Uncharacterized protein; structural genomics, join 9e-28
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Length = 381 Back     alignment and structure
 Score =  174 bits (442), Expect = 3e-52
 Identities = 52/245 (21%), Positives = 85/245 (34%), Gaps = 54/245 (22%)

Query: 54  QVFQWRALDFEYPSEEIRQYAKFTKDFVPENNLPVGIEV--WRNKLFVTVPRWEDGVPST 111
           Q ++W+ L +   +            + P+N +           KLF+ VPR    VP T
Sbjct: 4   QGYKWKQLLYNNVTPG---------SYNPDNMISTAFAYDAEGEKLFLAVPRKLPRVPYT 54

Query: 112 LNYIPLD----AATSSSPNLIPYPSWEANQVPPQPQDQCDTLTTTYRIKADSCDRLWVLD 167
           L  +            SP L  +   +              LT+ Y+   D C RLWV+D
Sbjct: 55  LAEVDTKNSLGVKGKHSPLLNKFSGHKT----------GKELTSIYQPVIDDCRRLWVVD 104

Query: 168 SGTVGIGNTTKQICPYA---IHVFDLKTDR--RIRKYQFRPEDILPGTFIANIAVDTDRR 222
            G+V   +   +  P     I  +DLK      + +Y F    +   T+    AVD    
Sbjct: 105 IGSVEYRSRGAKDYPSHRPAIVAYDLKQPNYPEVVRYYFPTRLVEKPTYFGGFAVDV--- 161

Query: 223 IRKYQFRPEDILPGTFIANIAVDVGKNCEDTFLYASDELAYGLLSYSWEENTSWRASHGF 282
                                 +   +C +TF+Y ++ L   L  Y  ++  SW  +H  
Sbjct: 162 ---------------------ANPKGDCSETFVYITNFLRGALFIYDHKKQDSWNVTHPT 200

Query: 283 FFPDP 287
           F  + 
Sbjct: 201 FKAER 205
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Length = 343 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
3q6k_A 381 43.2 kDa salivary protein; beta propeller, binding 100.0
2qe8_A 343 Uncharacterized protein; structural genomics, join 99.91
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.33
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.42
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 97.38
1q7f_A 286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.37
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.23
2p4o_A 306 Hypothetical protein; putative lactonase, structur 97.19
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.13
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.12
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.09
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 97.05
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.04
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.03
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.85
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.74
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.64
2fp8_A 322 Strictosidine synthase; six bladed beta propeller 96.62
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 96.59
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.59
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.5
3v65_B386 Low-density lipoprotein receptor-related protein; 96.39
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.38
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 96.34
3p5b_L400 Low density lipoprotein receptor variant; B-propel 96.3
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.29
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.29
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 96.17
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 96.1
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.05
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.05
1rwi_B 270 Serine/threonine-protein kinase PKND; beta propell 95.98
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.97
3v65_B386 Low-density lipoprotein receptor-related protein; 95.95
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.93
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 95.92
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 95.9
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 95.87
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.86
2fp8_A322 Strictosidine synthase; six bladed beta propeller 95.83
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 95.8
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 95.72
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 95.65
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 95.65
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 95.62
1pjx_A 314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 95.6
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.5
3p5b_L400 Low density lipoprotein receptor variant; B-propel 95.45
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 95.38
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 95.34
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 95.3
2p4o_A 306 Hypothetical protein; putative lactonase, structur 95.28
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 95.15
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 95.14
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.04
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.97
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 94.91
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 94.75
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 94.72
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 94.67
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 94.57
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 94.57
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 94.5
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 94.48
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 94.36
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 94.24
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 94.17
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 94.01
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 93.99
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 93.95
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 93.9
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 93.89
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 93.81
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 93.64
3qqz_A 255 Putative uncharacterized protein YJIK; MCSG, PSI-2 93.3
2qe8_A 343 Uncharacterized protein; structural genomics, join 93.26
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 93.24
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 93.11
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 93.01
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 92.98
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 92.98
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 92.95
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 92.58
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 92.58
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 92.42
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 92.33
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 91.94
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 91.66
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 91.6
3kya_A 496 Putative phosphatase; structural genomics, joint c 91.59
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 91.32
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 91.12
3kya_A 496 Putative phosphatase; structural genomics, joint c 90.65
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 90.53
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 90.21
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 90.19
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 90.19
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 90.16
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 89.73
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 89.48
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 89.47
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 89.46
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 89.29
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 88.87
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 88.86
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 88.31
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 88.0
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 87.9
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 87.06
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 86.88
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 85.04
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 84.62
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 83.79
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 83.08
2ece_A 462 462AA long hypothetical selenium-binding protein; 82.27
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 81.23
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 80.8
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 80.74
3ott_A 758 Two-component system sensor histidine kinase; beta 80.6
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
Probab=100.00  E-value=3.7e-59  Score=450.61  Aligned_cols=196  Identities=26%  Similarity=0.458  Sum_probs=180.2

Q ss_pred             ceEEEEEeeceeeCCCHHHHHhhhcCCCCCCCCCceeeeEE--eCCcEEEEeccCCCCCCcEEEEEeCCCCC---CCCCc
Q psy13477         52 LQQVFQWRALDFEYPSEEIRQYAKFTKDFVPENNLPVGIEV--WRNKLFVTVPRWEDGVPSTLNYIPLDAAT---SSSPN  126 (295)
Q Consensus        52 l~~vy~Wk~ldf~~ps~~~r~~ai~~g~Yip~n~~p~gi~v--~~gRiFvT~PR~~~gvP~TL~~i~~~~~~---~~sP~  126 (295)
                      ++++||||++||+         |+.+|.|+|+|++|+||++  ++||+|||+|||++|+|+||++|..+...   ..+|.
T Consensus         2 ~~~~~~Wk~ld~~---------ai~~g~y~p~n~~P~gv~vd~~~gRiFvt~PR~~~gvp~TL~~v~~~~~~~~~~~~p~   72 (381)
T 3q6k_A            2 DTQGYKWKQLLYN---------NVTPGSYNPDNMISTAFAYDAEGEKLFLAVPRKLPRVPYTLAEVDTKNSLGVKGKHSP   72 (381)
T ss_dssp             CCEEEEESSCCBT---------TSCTTSSCGGGCCCCEEEEETTTTEEEEECCTTSTTCSCSEEEEEHHHHTTCTTCSSC
T ss_pred             cceEEEEEeeccc---------cccCCCcccCccceeeeeeecCCCcEEEEeCCCCCCCCcEEEEEeCCCCcccccCCcc
Confidence            6899999999998         9999999999999999999  79999999999999999999999864321   24788


Q ss_pred             c-ccCCCccccCCCCCCCCCCCccEEEeEEEEcCCCcEEEEeCCCCCCCCCccc---cCCceEEEEECCCC--cEEEEEE
Q psy13477        127 L-IPYPSWEANQVPPQPQDQCDTLTTTYRIKADSCDRLWVLDSGTVGIGNTTKQ---ICPYAIHVFDLKTD--RRIRKYQ  200 (295)
Q Consensus       127 l-~PYPsw~~n~~~~~~~~~c~~lvsV~~i~iD~c~rLWVLDtG~~~~~~~~~~---~~~pKLvvfDL~td--~lir~y~  200 (295)
                      | +|||||          .+|++|+|||+++||+||||||||+|.++.++.+.|   .|+|||++|||+||  +++|+|+
T Consensus        73 ll~PYP~w----------~~~~~lvsV~~v~iD~~~rLWVLDtG~~~~~~~~~~~~~~~~pkLv~~DL~t~~~~li~~y~  142 (381)
T 3q6k_A           73 LLNKFSGH----------KTGKELTSIYQPVIDDCRRLWVVDIGSVEYRSRGAKDYPSHRPAIVAYDLKQPNYPEVVRYY  142 (381)
T ss_dssp             CBEECTTC----------SSSCSSSCEEEEEECTTCEEEEEECSSCSSCSTTGGGSCCCCCEEEEEESSSTTCCEEEEEE
T ss_pred             cccCCCCC----------ccccceEEeeEEEEcCCCcEEEEeCCCcCcCCCccccCCCCCceEEEEECCCCCceeEEEEE
Confidence            8 999998          168999999999999999999999999999888788   99999999999999  9999999


Q ss_pred             cCCCCCCCCceeeeeecchhhhhccccCCCcccCCCCCceeEEEeccC---CCCCeEEEEEcCCCCeEEEEEcCCCeEEE
Q psy13477        201 FRPEDILPGTFIANIAVDTDRRIRKYQFRPEDILPGTFIANIAVDVGK---NCEDTFLYASDELAYGLLSYSWEENTSWR  277 (295)
Q Consensus       201 ~p~~~~~~~~~~~~ia~~~~~~~~~~~~~~~~~~~~S~l~di~VD~~~---~c~~~~aYItD~~~~gLIVydl~~~~swR  277 (295)
                      ||++                           +++++|+|+||+||+..   +|+++||||||++.+||||||+++|++||
T Consensus       143 ~p~~---------------------------~~~~~S~l~di~VD~~~~~~~c~~~~aYItD~~~~gLIVydl~~~~swR  195 (381)
T 3q6k_A          143 FPTR---------------------------LVEKPTYFGGFAVDVANPKGDCSETFVYITNFLRGALFIYDHKKQDSWN  195 (381)
T ss_dssp             CCGG---------------------------GCCCGGGEEEEEEEESCTTTTSCSEEEEEEETTTTEEEEEETTTTEEEE
T ss_pred             CCHH---------------------------hcccCCccceEEEecccCCCCCCccEEEEEcCCCCcEEEEECCCCcEEE
Confidence            9998                           78889999999999532   69999999999999999999999999999


Q ss_pred             EecCCcccCCCCCCccc
Q psy13477        278 ASHGFFFPDPLLVPYKE  294 (295)
Q Consensus       278 v~h~~f~pdp~~~~f~~  294 (295)
                      ++|++|+|| .++.|+|
T Consensus       196 v~~~~~~pd-~~~~~~i  211 (381)
T 3q6k_A          196 VTHPTFKAE-RPTKFDY  211 (381)
T ss_dssp             EECGGGSCC-SCEEEEE
T ss_pred             EccCCCccc-cCcceEE
Confidence            999999999 6667765
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 97.56
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.04
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.75
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.65
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.6
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 96.58
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 96.49
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 96.45
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.42
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 96.41
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.37
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 96.33
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 95.36
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.31
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 94.77
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 94.4
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 94.24
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 93.98
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 93.97
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 93.68
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 93.24
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 92.22
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 91.73
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 90.56
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 89.95
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 88.8
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 88.38
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 87.49
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 86.31
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 84.12
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 82.2
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 80.35
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Calcium-dependent phosphotriesterase
family: All0351-like
domain: Hypothetical protein All0351 homologue
species: Nostoc punctiforme [TaxId: 272131]

Probab=97.56  E-value=0.0031  Score=53.74  Aligned_cols=123  Identities=15%  Similarity=0.056  Sum_probs=84.8

Q ss_pred             CCCCceeeeEEe-CCcEEEEeccCCCCCCcEEEEEeCCCCCCCCCccccCCCccccCCCCCCCCCCCccEEEeEEEEcCC
Q psy13477         82 PENNLPVGIEVW-RNKLFVTVPRWEDGVPSTLNYIPLDAATSSSPNLIPYPSWEANQVPPQPQDQCDTLTTTYRIKADSC  160 (295)
Q Consensus        82 p~n~~p~gi~v~-~gRiFvT~PR~~~gvP~TL~~i~~~~~~~~sP~l~PYPsw~~n~~~~~~~~~c~~lvsV~~i~iD~c  160 (295)
                      |.+..|.|+++. +|+||+|-+.     ..++-.+..++      ..+.++.     .          --.+.++.+|.+
T Consensus        25 p~~~~~e~iAv~pdG~l~vt~~~-----~~~I~~i~p~g------~~~~~~~-----~----------~~~~~gla~~~d   78 (302)
T d2p4oa1          25 PVNTFLENLASAPDGTIFVTNHE-----VGEIVSITPDG------NQQIHAT-----V----------EGKVSGLAFTSN   78 (302)
T ss_dssp             CTTCCEEEEEECTTSCEEEEETT-----TTEEEEECTTC------CEEEEEE-----C----------SSEEEEEEECTT
T ss_pred             CCCCCcCCEEECCCCCEEEEeCC-----CCEEEEEeCCC------CEEEEEc-----C----------CCCcceEEEcCC
Confidence            334468899997 9999999754     23777777553      2333221     1          024678899999


Q ss_pred             CcEEEEeCCCCCCCCCccccCCceEEEEEC--CCCcEEEEEEcCCCCCCCCceeeeeecchhhhhccccCCCcccCCCCC
Q psy13477        161 DRLWVLDSGTVGIGNTTKQICPYAIHVFDL--KTDRRIRKYQFRPEDILPGTFIANIAVDTDRRIRKYQFRPEDILPGTF  238 (295)
Q Consensus       161 ~rLWVLDtG~~~~~~~~~~~~~pKLvvfDL--~td~lir~y~~p~~~~~~~~~~~~ia~~~~~~~~~~~~~~~~~~~~S~  238 (295)
                      |+|||.+.+.-            +|..+++  .+++..+....+.                                ..+
T Consensus        79 G~l~v~~~~~~------------~~~~~~~~~~~~~~~~~~~~~~--------------------------------~~~  114 (302)
T d2p4oa1          79 GDLVATGWNAD------------SIPVVSLVKSDGTVETLLTLPD--------------------------------AIF  114 (302)
T ss_dssp             SCEEEEEECTT------------SCEEEEEECTTSCEEEEEECTT--------------------------------CSC
T ss_pred             CCeEEEecCCc------------eEEEEEecccccceeeccccCC--------------------------------ccc
Confidence            99999986542            2334444  3344444444433                                256


Q ss_pred             ceeEEEeccCCCCCeEEEEEcCCCCeEEEEEcCCCeEEEEe
Q psy13477        239 IANIAVDVGKNCEDTFLYASDELAYGLLSYSWEENTSWRAS  279 (295)
Q Consensus       239 l~di~VD~~~~c~~~~aYItD~~~~gLIVydl~~~~swRv~  279 (295)
                      .+++++|.     ++.+|++|.....+..+|..++..+.+.
T Consensus       115 ~n~i~~~~-----~g~~~v~~~~~~~i~~~~~~~~~~~~~~  150 (302)
T d2p4oa1         115 LNGITPLS-----DTQYLTADSYRGAIWLIDVVQPSGSIWL  150 (302)
T ss_dssp             EEEEEESS-----SSEEEEEETTTTEEEEEETTTTEEEEEE
T ss_pred             cceeEEcc-----CCCEEeeccccccceeeeccCCcceeEe
Confidence            89999984     6789999999999999999999988876
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure