Diaphorina citri psyllid: psy13481

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-

MSGLTPDAINKLQLFLGAVKKNPAIFYLPELKFFKDFVESYGGTIPPPSKAQSDAPKPEKPFTTPEPSAPEEESEESDPELDNTGVISEPDEEEPIPDVATDIEVSEEDIDKSNEKKREAIHAYNDGKFEDAVNAYSEAIKLNPSSALLYAKRGQSYLQLSKPNACIRDCSVALKINPDSAAAYKFRGRAYRLLGKWEEAAVDLRNACKIDFDEQADEWLKEVTPNKLNLK

cccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHcHHHcccc

******DAINKLQLFLGAVKKNPAIFYLPELKFFKDFVESYGG****************************************************************EDIDKSNEKKREAIHAYNDGKFEDAVNAYSEAIKLNPSSALLYAKRGQSYLQLSKPNACIRDCSVALKINPDSAAAYKFRGRAYRLLGKWEEAAVDLRNACKIDFDEQADEWLKEVTPNKL*L*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Hsc70-interacting protein	One HIP oligomer binds the ATPase domains of at least two HSC70 molecules dependent on activation of the HSC70 ATPase by HSP40. Stabilizes the ADP state of HSC70 that has a high affinity for substrate protein. Through its own chaperone activity, it may contribute to the interaction of HSC70 with various target proteins.	confident	Q5ZLF0

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044422 [CC]	organelle part	probable	GO:0005575, GO:0043226
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032564 [MF]	dATP binding	probable	GO:0043168, GO:0030554, GO:0000166, GO:0097159, GO:0043167, GO:0036094, GO:0003674, GO:0032558, GO:0017076, GO:0032554, GO:0032552, GO:1901363, GO:1901265, GO:0005488
GO:0032403 [MF]	protein complex binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0061084 [BP]	negative regulation of protein refolding	probable	GO:0032269, GO:0032268, GO:0010605, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0031324, GO:0031323, GO:0051248, GO:0050794, GO:0008150, GO:0065007, GO:0061083, GO:0048519, GO:0009892, GO:0050789, GO:0048523
GO:0042802 [MF]	identical protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0070389 [BP]	chaperone cofactor-dependent protein refolding	probable	GO:0044267, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0042026, GO:0008152, GO:0008150, GO:0061077
GO:0051082 [MF]	unfolded protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0051260 [BP]	protein homooligomerization	probable	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FP2, chain A
Confidence level:very confident
Coverage over the Query: 108-209
View the alignment between query and template
View the model in PyMOL

Template: 3UGM, chain A
Confidence level:probable
Coverage over the Query: 127-219
View the alignment between query and template
View the model in PyMOL