Diaphorina citri psyllid: psy13485


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MSGFLHVCPASGGIFENLSDVFHGCDNAAASTPLHQLVGVVTYYGKHYSTFFFHTKLKVWIYFDDATVREVGPRWEQVRSAFYFFNSEYTLYSAAPKASLLPLPLSLYKLELTRPFPSFSGCGEVQARPLPAAPTPILWGFTDFRFGDDLKS
cccccHHHHHccccccccccccccccccccccccEEEEEEEEEccccEEEEEEEccccEEEEEEccccEEccccHHHHHHHHcccccCEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
**GFLHVCPASGGIFENLSDVFHGCDNAAASTPLHQLVGVVTYYGKHYSTFFFHTKLKVWIYFDDATVREVGPRWEQVRSAFYFFNSEYTLYSAAPKASLLPLPLSLYKL*************EVQARPLPAAPTPILWGFTDFRFG*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGFLHVCPASGGIFENLSDVFHGCDNAAASTPLHQLVGVVTYYGKHYSTFFFHTKLKVWIYFDDATVREVGPRWEQVRSAFYFFNSEYTLYSAAPKASLLPLPLSLYKLELTRPFPSFSGCGEVQARPLPAAPTPILWGFTDFRFGDDLKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Inactive ubiquitin carboxyl-terminal hydrolase 54 Has no peptidase activity.confidentQ70EL1
Inactive ubiquitin carboxyl-terminal hydrolase 54 Has no peptidase activity.confidentQ8BL06
Inactive ubiquitin carboxyl-terminal hydrolase 54 Has no peptidase activity.confidentQ6IE24

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016579 [BP]protein deubiquitinationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0004843 [MF]ubiquitin-specific protease activityprobableGO:0016787, GO:0019783, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NB8, chain A
Confidence level:confident
Coverage over the Query: 12-97
View the alignment between query and template
View the model in PyMOL