Diaphorina citri psyllid: psy1348

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MACGLAGGLSGLISWALIMPFDVVKSTLQSDSLTDPKYKGMFDCFRKNYRQYGWTFFFRGISITTIRAFPVNYIMFVTYEEFKCHCL
ccHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHc
MACGLAGGLSGLISWALIMPFDVVKSTLQSDSLTDPKYKGMFDCFRKNYRQYGWTFFFRGISITTIRAFPVNYIMFVTYEEFKCHCL
xxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxx
SSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACGLAGGLSGLISWALIMPFDVVKSTLQSDSLTDPKYKGMFDCFRKNYRQYGWTFFFRGISITTIRAFPVNYIMFVTYEEFKCHCL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial carnitine/acylcarnitine carrier protein CACL Has palmitoylcarnitine transporting activity.confidentQ8BL03
Mitochondrial carnitine/acylcarnitine carrier protein CACL Has palmitoylcarnitine transporting activity.confidentQ8N8R3
Mitochondrial carnitine/acylcarnitine carrier protein CACL Has palmitoylcarnitine transporting activity.confidentQ08DK7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006839 [BP]mitochondrial transportprobableGO:0009987, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0015179 [MF]L-amino acid transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0015171, GO:0046943
GO:0008324 [MF]cation transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0015075, GO:0022857, GO:0003674
GO:0044710 [BP]single-organism metabolic processprobableGO:0008150, GO:0008152
GO:0006844 [BP]acyl carnitine transportprobableGO:0051181, GO:0006810, GO:0071705, GO:0044765, GO:0008150, GO:0015697, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0015227 [MF]acyl carnitine transmembrane transporter activityprobableGO:0022891, GO:0005215, GO:0022857, GO:0022892, GO:0003674
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0006862 [BP]nucleotide transportprobableGO:0015931, GO:0015748, GO:0006810, GO:0071705, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0006865 [BP]amino acid transportprobableGO:0044765, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0071705, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0015297 [MF]antiporter activityprobableGO:0005215, GO:0022857, GO:0015291, GO:0003674, GO:0022804
GO:0055085 [BP]transmembrane transportprobableGO:0006810, GO:0009987, GO:0044765, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 2-85
View the alignment between query and template
View the model in PyMOL