Diaphorina citri psyllid: psy13491


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------7
MKAKRDEVQTAMAMDESLFRGRQIKVNPKRTNRPGISTTNRGGPRGRGRGRVSRGAAMYGGYRPVRRAR
ccccHHHHHHHHHccccccccccEEEccccccccccccccccccccccccccccccccccccccccccc
**********AMAMDESLFRGRQIKVNPKRTNRP***********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAKRDEVQTAMAMDESLFRGRQIKVNPKRTNRPGISTTNRGGPRGRGRGRVSRGAAMYGGYRPVRRAR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polyadenylate-binding protein 2 Involved in the 3'-end formation of mRNA precursors (pre-mRNA) by the addition of a poly(A) tail of 200-250 nt to the upstream cleavage product. Stimulates poly(A) polymerase (PAPOLA) conferring processivity on the poly(A) tail elongation reaction and controls also the poly(A) tail length. Increases the affinity of poly(A) polymerase for RNA. Binds to poly(A) and to poly(G) with high affinity. May protect the poly(A) tail from degradation.confidentQ6NVP7
Polyadenylate-binding protein 2 Involved in the 3'-end formation of mRNA precursors (pre-mRNA) by the addition of a poly(A) tail of 200-250 nt to the upstream cleavage product. Stimulates poly(A) polymerase (PAPOLA) conferring processivity on the poly(A) tail elongation reaction and controls also the poly(A) tail length. Increases the affinity of poly(A) polymerase for RNA. Binds to poly(A) and to poly(G) with high affinity. May protect the poly(A) tail from degradation.confidentQ7KNF2
Polyadenylate-binding protein 2 Involved in the 3'-end formation of mRNA precursors (pre-mRNA) by the addition of a poly(A) tail of 200-250 nt to the upstream cleavage product. Stimulates poly(A) polymerase (PAPOLA) conferring processivity on the poly(A) tail elongation reaction and controls also the poly(A) tail length. Increases the affinity of poly(A) polymerase for RNA. Is also present at various stages of mRNA metabolism including nucleocytoplasmic trafficking and nonsense-mediated decay (NMD) of mRNA. Cooperates with SKIP to synergistically activate E-box-mediated transcription through MYOD1 and may regulate the expression of muscle-specific genes. Binds to poly(A) and to poly(G) with high affinity. May protect the poly(A) tail from degradation.confidentQ8CCS6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusconfidentGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030529 [CC]ribonucleoprotein complexprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0008143 [MF]poly(A) RNA bindingprobableGO:0005488, GO:0097159, GO:0070717, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:1901363, GO:0003729
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0019058 [BP]viral infectious cycleprobableGO:0044703, GO:0000003, GO:0009987, GO:0022415, GO:0022414, GO:0044764, GO:0008150, GO:0016032, GO:0051704
GO:0006936 [BP]muscle contractionprobableGO:0032501, GO:0044707, GO:0003012, GO:0008150, GO:0044699, GO:0003008
GO:0000398 [BP]mRNA splicing, via spliceosomeprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0006378 [BP]mRNA polyadenylationprobableGO:0090304, GO:0034641, GO:0006807, GO:0043631, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0044238, GO:0031124, GO:0009987, GO:0006725, GO:0031123, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0006369 [BP]termination of RNA polymerase II transcriptionprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006353, GO:0019438
GO:0046778 [BP]modification by virus of host mRNA processingprobableGO:0019222, GO:0019048, GO:0050789, GO:0000003, GO:0039656, GO:0044419, GO:0051817, GO:0044792, GO:0065007, GO:0065008, GO:0010468, GO:0019054, GO:0060255, GO:0009987, GO:0050794, GO:0022415, GO:0022414, GO:0044764, GO:0008150, GO:0051701, GO:0044003, GO:0051704, GO:0044703, GO:0044068, GO:0016032, GO:0044403, GO:0035821
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0016973 [BP]poly(A)+ mRNA export from nucleusprobableGO:0015931, GO:0051169, GO:0051168, GO:0051641, GO:0051028, GO:0044699, GO:0071705, GO:0071702, GO:0006403, GO:0006405, GO:0006406, GO:0009987, GO:0006810, GO:0006913, GO:0044765, GO:0008150, GO:0051649, GO:0051236, GO:0051234, GO:0051179, GO:0016482, GO:0050658, GO:0033036, GO:0046907, GO:0050657, GO:0044763

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JWN, chain A
Confidence level:very confident
Coverage over the Query: 3-39
View the alignment between query and template
View the model in PyMOL