Diaphorina citri psyllid: psy13494


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MSTCQREGKDFIIFATKEDHAIPSSVELPPPEPQPGLILPDGSINWNCPCLGGMATGPCGVQFREAFSCFHYSTDEPKGVNCFEAFKTMQDCMAQYPTLYKQNDDDDEDLDDVKDESIRKEAQEKADRIIEQADSGSSHTNKK
ccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccc
******EGKDFIIFAT********************LILPDGSINWNCPCLGGMATGPCGVQFREAFSCFHYSTDEPKGVNCFEAFKTMQDCMAQYPTLY*******************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTCQREGKDFIIFATKEDHAIPSSVELPPPEPQPGLILPDGSINWNCPCLGGMATGPCGVQFREAFSCFHYSTDEPKGVNCFEAFKTMQDCMAQYPTLYKQNDDDDEDLDDVKDESIRKEAQEKADRIIEQADSGSSHTNKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial intermembrane space import and assembly protein 40 Required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS). Probably acts by forming a redox cycle with GFER/ERV1 that involves a disulfide relay system. Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria. The oxidized form of MIA40 forms a transient intermolecular disulfide bridge with the reduced precursor protein, resulting in oxidation of the precursor protein that now contains an intramolecular disulfide bond and is able to undergo folding in the IMS.very confidentQ8VEA4
Mitochondrial intermembrane space import and assembly protein 40 Required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS). Probably acts by forming a redox cycle with GFER/ERV1 that involves a disulfide relay system. Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria. The oxidized form of MIA40 forms a transient intermolecular disulfide bridge with the reduced precursor protein, resulting in oxidation of the precursor protein that now contains an intramolecular disulfide bond and is able to undergo folding in the IMS.very confidentQ5BJN5
Mitochondrial intermembrane space import and assembly protein 40 Required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS). Probably acts by forming a redox cycle with GFER/ERV1 that involves a disulfide relay system. Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria. The oxidized form of MIA40 forms a transient intermolecular disulfide bridge with the reduced precursor protein, resulting in oxidation of the precursor protein that now contains an intramolecular disulfide bond and is able to undergo folding in the IMS.confidentQ6PBC3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005758 [CC]mitochondrial intermembrane spaceprobableGO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429
GO:0045041 [BP]protein import into mitochondrial intermembrane spaceprobableGO:0008104, GO:0051649, GO:0071840, GO:0044699, GO:0071806, GO:0070727, GO:0006886, GO:0016043, GO:0051179, GO:0065002, GO:0007005, GO:0071702, GO:0051641, GO:0034613, GO:0017038, GO:0072594, GO:0006626, GO:0006810, GO:0006605, GO:0045184, GO:0033365, GO:0044765, GO:0008150, GO:0072655, GO:0006839, GO:0051234, GO:0055085, GO:0044743, GO:0016482, GO:0006996, GO:0070585, GO:0033036, GO:0046907, GO:0015031, GO:0044763, GO:0009987
GO:0022417 [BP]protein maturation by protein foldingprobableGO:0044267, GO:0006457, GO:0051604, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152
GO:0051084 [BP]'de novo' posttranslational protein foldingprobableGO:0044267, GO:0009987, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0006458, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005742 [CC]mitochondrial outer membrane translocase complexprobableGO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031968, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0005741, GO:0044429, GO:0044424, GO:0044425, GO:0044422
GO:0015035 [MF]protein disulfide oxidoreductase activityprobableGO:0003824, GO:0016491, GO:0003674, GO:0016667, GO:0015036

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2K3J, chain A
Confidence level:very confident
Coverage over the Query: 36-100
View the alignment between query and template
View the model in PyMOL