Diaphorina citri psyllid: psy13497

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--

MSSNEIAKVEESHPEHPRNLIPELCKQFYHLGWVTGTGGGMTIKLGDEIYIAPSGVQKERLTSKDLFVQDMEGKDLQLPEDKTLKKSQCTPLFMCSYTLRNAGAVIHTHSKAAVLVTMLYPGNVSIELVSSYLGNIFQLKFFVQFTYNWYLVAYCWSNVFRIAYQEMIKGTWNSTLGRYNRYDEELVVPIIENTPQEKDLRDSLERALVEFPSTSAVLVRRHGVYVWGGDWKSTKTQTECYDYLFELAVSMKQLGLNPLSPP

ccccccccccccccccHHHHHHHHHHHHHHccccccccccEEEECccEEEEEcccccccccccccEEEEEccccCCccccccccccccccHHHHHHHHcccccEEEEEccHHHHHHHHHcccccHHHHHHHHccccccccccccccccHHHHHHHcccEEEEccHHHHHHccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHccccCEEEEcccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHccccccccc

****************PRNLIPELCKQFYHLGWVTGTGGGMTIKLGDEIYIAPSGVQKERLTSKDLFVQDMEGKDLQ******LKKSQCTPLFMCSYTLRNAGAVIHTHSKAAVLVTMLYPGNVSIELVSSYLGNIFQLKFFVQFTYNWYLVAYCWSNVFRIAYQEMIKGTWNSTLGRYNRYDEELVVPIIENTPQEKDLRDSLERALVEFPSTSAVLVRRHGVYVWGGDWKSTKTQTECYDYLFELAVSMKQLGLN*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable methylthioribulose-1-phosphate dehydratase	Catalyzes the dehydration of methylthioribulose-1-phosphate (MTRu-1-P) into 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P).	very confident	Q7PS09
Methylthioribulose-1-phosphate dehydratase	Catalyzes the dehydration of methylthioribulose-1-phosphate (MTRu-1-P) into 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P). May play a role in apoptosis.	very confident	Q66I75
Methylthioribulose-1-phosphate dehydratase	Catalyzes the dehydration of methylthioribulose-1-phosphate (MTRu-1-P) into 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P). Has an anti-apoptotic function and prevents muscle ischemic damage. Inhibits the cytochrome c-dependent and APAF1-mediated cell death.	very confident	Q0VCJ2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0046570 [MF]	methylthioribulose 1-phosphate dehydratase activity	probable	GO:0016835, GO:0016836, GO:0003674, GO:0016829, GO:0003824
GO:0019509 [BP]	L-methionine salvage from methylthioadenosine	probable	GO:0071267, GO:0019752, GO:0071265, GO:0044249, GO:0006807, GO:0009067, GO:0009066, GO:0044283, GO:1901576, GO:0044710, GO:0044711, GO:0006520, GO:0071704, GO:0043102, GO:1901605, GO:1901607, GO:0009987, GO:0044238, GO:0000097, GO:0000096, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0043094, GO:0008652, GO:1901564, GO:0006082, GO:1901566, GO:0044272, GO:0046394, GO:0006555, GO:0016053, GO:0044237, GO:0006790, GO:0009086, GO:0044281
GO:0043066 [BP]	negative regulation of apoptotic process	probable	GO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0046872 [MF]	metal ion binding	probable	GO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006595 [BP]	polyamine metabolic process	probable	GO:1901564, GO:0009308, GO:0006576, GO:0044106, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0042802 [MF]	identical protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
4.-.-.-	Lyases.	probable
4.2.-.-	Carbon-oxygen lyases.	probable
4.2.1.-	Hydro-lyases.	probable
4.2.1.109	Methylthioribulose 1-phosphate dehydratase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IRP, chain A
Confidence level:very confident
Coverage over the Query: 15-127,162-255
View the alignment between query and template
View the model in PyMOL

Template: 1K0W, chain A
Confidence level:very confident
Coverage over the Query: 15-130,149-166,181-260
View the alignment between query and template
View the model in PyMOL