Diaphorina citri psyllid: psy13511


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MTSRGRTFSGIIKSFLETSGPLNDTYLPLYETDAGRRVYDATLASVRENFPQYVEEIEGTADGAKVPFHKMSRKLKERPTELRSLSTR
ccHHHHHHHHHHHHHHHHcccHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHHHcccccccccHHHHcHHccccccHHHccccc
*****RTFSGIIKSFLETSGPLNDTYLPLYETDAGRRVYDATLASVRENFPQYVEEIEGTADGAKVPFHKMSRKLK************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSRGRTFSGIIKSFLETSGPLNDTYLPLYETDAGRRVYDATLASVRENFPQYVEEIEGTADGAKVPFHKMSRKLKERPTELRSLSTR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001694 [BP]histamine biosynthetic processprobableGO:0044249, GO:0034641, GO:0006807, GO:1901362, GO:1901360, GO:1901576, GO:0071704, GO:0018130, GO:0009308, GO:0009309, GO:0009987, GO:0006725, GO:0044106, GO:0009058, GO:0008150, GO:0008152, GO:1901564, GO:0046483, GO:0044271, GO:0006576, GO:1901566, GO:0042401, GO:0044237, GO:0052803, GO:0019438, GO:0001692
GO:0031964 [MF]beta-alanyl-histamine hydrolase activityprobableGO:0016787, GO:0003674, GO:0003824
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042416 [BP]dopamine biosynthetic processprobableGO:0044249, GO:0006807, GO:1901362, GO:0042423, GO:1901360, GO:1901576, GO:0009713, GO:0009712, GO:0071704, GO:0046189, GO:0009987, GO:0006725, GO:0006584, GO:0042417, GO:0009058, GO:0008150, GO:0008152, GO:0018958, GO:1901564, GO:1901566, GO:0044237, GO:0019438, GO:1901617, GO:1901615

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X1D, chain A
Confidence level:confident
Coverage over the Query: 2-77
View the alignment between query and template
View the model in PyMOL