Diaphorina citri psyllid: psy13520


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MANIRRLSDFTARSSFSSATMPQPTQPINLVMCESLSVPCAPVDIEEPALSKRRTDSYSTQPINLIMCESLSVPCAPVDIEEPALSKRRTDSYSEINGGESPGVAADWVPSLWSIMNKVKLEAMMWGAGTALGELPPYFLSRAARLSLLDPDDVDDLTLVDKLKLKIETLVNKVGFFGILACASIPNPLFDLAGITCGHFLIPFWTFFGATLIGKAVIKMSIQGNKWVPGTRGYVTIS
ccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEcc
********DFTA***********PTQPINLVMCESLSVPCAPVDIEEPAL****TDSYSTQPINLIMCESLSVPCAPVDIEEPALSKRRTDSYSEINGGESPGVAADWVPSLWSIMNKVKLEAMMWGAGTALGELPPYFLSRAARLSLLDPDDVDDLTLVDKLKLKIETLVNKVGFFGILACASIPNPLFDLAGITCGHFLIPFWTFFGATLIGKAVIKMSIQGNKWVPGTRGYVTI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANIRRLSDFTARSSFSSATMPQPTQPINLVMCESLSVPCAPVDIEEPALSKRRTDSYSTQPINLIMCESLSVPCAPVDIEEPALSKRRTDSYSEINGGESPGVAADWVPSLWSIMNKVKLEAMMWGAGTALGELPPYFLSRAARLSLLDPDDVDDLTLVDKLKLKIETLVNKVGFFGILACASIPNPLFDLAGITCGHFLIPFWTFFGATLIGKAVIKMSIQGNKWVPGTRGYVTIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuole membrane protein 1 Stress-induced protein that, when overexpressed, promotes formation of intracellular vacuoles followed by cell death. May be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. Plays a role in the initial stages of the autophagic process through its interaction with BECN1 (By similarity). Involved in cell-cell adhesion. Plays an essential role in formation of cell junctions.confidentQ96GC9
Vacuole membrane protein 1 confidentQ68EQ9
Vacuole membrane protein 1 Stress-induced protein that, when overexpressed, promotes formation of intracellular vacuoles followed by cell death. May be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. Involved in cell-cell adhesion (By similarity). Plays an essential role in formation of cell junctions (By similarity). Plays a role in the initial stages of the autophagic process through its interaction with BECN1.confidentQ91ZQ0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0000331 [CC]contractile vacuoleprobableGO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0043229, GO:0005623, GO:0031988, GO:0005575, GO:0005773, GO:0044444, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0000407 [CC]pre-autophagosomal structureprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000421 [CC]autophagic vacuole membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043229, GO:0005773, GO:0016020, GO:0044464, GO:0005776, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0007566 [BP]embryo implantationprobableGO:0032502, GO:0044703, GO:0044702, GO:0000003, GO:0044707, GO:0044706, GO:0007565, GO:0022414, GO:0032501, GO:0008150, GO:0007275, GO:0044699, GO:0051704
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LVG, chain A
Confidence level:probable
Coverage over the Query: 15-63
View the alignment between query and template
View the model in PyMOL