Diaphorina citri psyllid: psy13524


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
SFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRINLGIFIPSAIFRVTAVCGDFYIGGRQFDSLSDLISYYSSCSDLLKRERLAHPCPPPEPVNDKKRIVAILPYTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPVNFTISESDSTFL
ccEEcccccccccEEEEEEEccEEEEEEEEEcccEEEEcccccccHHHHHHHcccccccccccccccCECcccccccccccEEEEEccccEEEcccccccccccccccccccHHHHccccccccccccccccccEEEEEEcccccccccccccccccEEEEEEcccccCEEEEEccccEEEEEEcccccccccccccccccccccccccHHHHHHHHccccccEEEEEccccccc
SFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRINLGIFIPSAIFRVTAVCGDFYIGGRQFDSLSDLISYYSSCSDLLKRERL************KKRIVAILPYTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPVNFTISES*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRINLGIFIPSAIFRVTAVCGDFYIGGRQFDSLSDLISYYSSCSDLLKRERLAHPCPPPEPVNDKKRIVAILPYTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPVNFTISESDSTFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras GTPase-activating protein 1 Inhibitory regulator of the Ras-cyclic AMP pathway. Stimulates the GTPase of normal but not oncogenic Ras p21.confidentP09851
Ras GTPase-activating protein 1 Inhibitory regulator of the Ras-cyclic AMP pathway. Stimulates the GTPase of normal but not oncogenic Ras p21.confidentP50904

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048149 [BP]behavioral response to ethanolprobableGO:1901700, GO:0030534, GO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0007610, GO:0045471, GO:0008150, GO:0042221, GO:0097305, GO:0010033, GO:0044699
GO:0040008 [BP]regulation of growthprobableGO:0008150, GO:0065007, GO:0050789
GO:0010741 [BP]negative regulation of intracellular protein kinase cascadeprobableGO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0010627, GO:0050789, GO:0048523
GO:0016319 [BP]mushroom body developmentprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GRI, chain A
Confidence level:very confident
Coverage over the Query: 1-63,118-193
View the alignment between query and template
View the model in PyMOL
Template: 2OZO, chain A
Confidence level:very confident
Coverage over the Query: 1-126
View the alignment between query and template
View the model in PyMOL
Template: 1K9A, chain A
Confidence level:very confident
Coverage over the Query: 132-233
View the alignment between query and template
View the model in PyMOL