Psyllid ID: psy13524


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
SFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRINLGIFIPSAIFRVTAVCGDFYIGGRQFDSLSDLISYYSSCSDLLKRERLAHPCPPPEPVNDKKRIVAILPYTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPVNFTISESDSTFL
ccEEcccccccccEEEEEEEccEEEEEEEEEcccEEEEcccccccHHHHHHHcccccccccccccccEEEcccccccccccEEEEEccccEEEcccccccccccccccccccHHHHHcccccccccccccccccEEEEEEcccccccccccccccccEEEEEEcccccEEEEEEccccEEEEEEcccccccccccccccccccccccccHHHHHHHHccccccEEEEEccccccc
cEEEEccccccccEEEEEEEcccEEEEEEEccccEEEEcccccccHHHHHHHHHccccEccEEEEccccccccccccHHHHEEEEHccccEEEcccccccHHHHHHHHccccHcccccEEEcccccccccccccEEEEEEEccccccccccEEEcccEEEEEEccccccEEEEEcccccEEEEcHHHHHHccccccccccccHHcccccHHHHHHHHccccccEEEEEccccccc
sflvrpsdnspgdyslFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQiveghtlgfpvtrinlgifipsAIFRVTAVCgdfyiggrqfdSLSDLISYYSSCSDLLkrerlahpcpppepvndkkrIVAIlpytkmpdtdeltfqkgDIFFVHnelgdgwlWVTAHRTGEQGMIFRDLVEdldetidpntvfdwfhpectkndAVDMLVKagpvnftisesdstfl
sflvrpsdnspgdysLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVeghtlgfpvTRINLGIFIPSAIFRVTAVCGDFYIGGRQFDSLSDLISYYSSCSDLLKRERLAhpcpppepvndkkRIVAILPYTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPvnftisesdstfl
SFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRINLGIFIPSAIFRVTAVCGDFYIGGRQFdslsdlisyysscsdllKRERLAHPCPPPEPVNDKKRIVAILPYTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPVNFTISESDSTFL
*************YSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRINLGIFIPSAIFRVTAVCGDFYIGGRQFDSLSDLISYYSSCSDLLKRERL*************KRIVAILPYTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPVNFT*********
SFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRINLGIFIPSAIFRVTAVCGDFYIGGRQFDSLSDLISYYSSCSDLLK****************KKRIVAILPYTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPVNFTISESDS***
*********SPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRINLGIFIPSAIFRVTAVCGDFYIGGRQFDSLSDLISYYSSCSDLLKRERLAHPCPPPEPVNDKKRIVAILPYTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPVNFTI********
SFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRINLGIFIPSAIFRVTAVCGDFYIGGRQFDSLSDLISYYSSCSDLLKRERLAHPCPPPEPVNDKKRIVAILPYTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPVNFTISES*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRINLGIFIPSAIFRVTAVCGDFYIGGRQFDSLSDLISYYSSCSDLLKRERLAHPCPPPEPVNDKKRIVAILPYTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPVNFTISESDSTFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query235 2.2.26 [Sep-21-2011]
P50904 1038 Ras GTPase-activating pro yes N/A 0.646 0.146 0.568 6e-47
P20936 1047 Ras GTPase-activating pro no N/A 0.646 0.145 0.568 7e-47
P09851 1044 Ras GTPase-activating pro yes N/A 0.646 0.145 0.562 2e-46
P35991 659 Tyrosine-protein kinase B no N/A 0.442 0.157 0.229 4e-05
O77506263 LIM and SH3 domain protei no N/A 0.263 0.235 0.365 7e-05
Q61792263 LIM and SH3 domain protei no N/A 0.263 0.235 0.365 9e-05
Q99MZ8263 LIM and SH3 domain protei no N/A 0.263 0.235 0.365 9e-05
Q3B7M5260 LIM and SH3 domain protei no N/A 0.263 0.238 0.365 9e-05
Q5R5W0261 LIM and SH3 domain protei no N/A 0.263 0.237 0.365 0.0001
Q14847261 LIM and SH3 domain protei no N/A 0.263 0.237 0.365 0.0001
>sp|P50904|RASA1_RAT Ras GTPase-activating protein 1 OS=Rattus norvegicus GN=Rasa1 PE=3 SV=1 Back     alignment and function desciption
 Score =  187 bits (474), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 87/153 (56%), Positives = 114/153 (74%), Gaps = 1/153 (0%)

Query: 82  FRVTAVCGDFYIGGRQFDSLSDLISYYSSCSDLLKRERLAHPCPPPEPVNDKKRIVAILP 141
           FR+ A+CGD+YIGGR+F SLSDLI YYS  S LLK E+L +P  PPEPV D++R+ AILP
Sbjct: 221 FRIIAMCGDYYIGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILP 280

Query: 142 YTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVF 201
           YTK+PDTDE++F KGD+F VHNEL DGW+WVT  RT EQG+I  DLVE++    DP+   
Sbjct: 281 YTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGK 340

Query: 202 DWFHPECTKNDAVDMLVKAGPV-NFTISESDST 233
            WFH + +K +A ++L+  G V +F +  SD+T
Sbjct: 341 IWFHGKISKQEAYNLLMTVGQVCSFLVRPSDNT 373




Inhibitory regulator of the Ras-cyclic AMP pathway. Stimulates the GTPase of normal but not oncogenic Ras p21.
Rattus norvegicus (taxid: 10116)
>sp|P20936|RASA1_HUMAN Ras GTPase-activating protein 1 OS=Homo sapiens GN=RASA1 PE=1 SV=1 Back     alignment and function description
>sp|P09851|RASA1_BOVIN Ras GTPase-activating protein 1 OS=Bos taurus GN=RASA1 PE=1 SV=1 Back     alignment and function description
>sp|P35991|BTK_MOUSE Tyrosine-protein kinase BTK OS=Mus musculus GN=Btk PE=1 SV=4 Back     alignment and function description
>sp|O77506|LASP1_RABIT LIM and SH3 domain protein 1 OS=Oryctolagus cuniculus GN=LASP1 PE=1 SV=1 Back     alignment and function description
>sp|Q61792|LASP1_MOUSE LIM and SH3 domain protein 1 OS=Mus musculus GN=Lasp1 PE=1 SV=1 Back     alignment and function description
>sp|Q99MZ8|LASP1_RAT LIM and SH3 domain protein 1 OS=Rattus norvegicus GN=Lasp1 PE=1 SV=1 Back     alignment and function description
>sp|Q3B7M5|LASP1_BOVIN LIM and SH3 domain protein 1 OS=Bos taurus GN=LASP1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R5W0|LASP1_PONAB LIM and SH3 domain protein 1 OS=Pongo abelii GN=LASP1 PE=2 SV=1 Back     alignment and function description
>sp|Q14847|LASP1_HUMAN LIM and SH3 domain protein 1 OS=Homo sapiens GN=LASP1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query235
193606011 927 PREDICTED: ras GTPase-activating protein 0.642 0.162 0.842 3e-73
332016402 945 Ras GTPase-activating protein 1 [Acromyr 0.646 0.160 0.809 1e-72
383851951 945 PREDICTED: ras GTPase-activating protein 0.646 0.160 0.809 1e-72
328789390 945 PREDICTED: ras GTPase-activating protein 0.646 0.160 0.809 1e-72
340710276 945 PREDICTED: ras GTPase-activating protein 0.646 0.160 0.809 1e-72
350423569 945 PREDICTED: ras GTPase-activating protein 0.646 0.160 0.809 1e-72
307187657 936 Ras GTPase-activating protein 1 [Campono 0.646 0.162 0.809 2e-72
328789388 907 PREDICTED: ras GTPase-activating protein 0.646 0.167 0.809 2e-72
307193743 917 Ras GTPase-activating protein 1 [Harpegn 0.646 0.165 0.809 2e-72
194894020 954 GG19350 [Drosophila erecta] gi|190649639 0.646 0.159 0.815 1e-71
>gi|193606011|ref|XP_001942745.1| PREDICTED: ras GTPase-activating protein 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 141/152 (92%)

Query: 82  FRVTAVCGDFYIGGRQFDSLSDLISYYSSCSDLLKRERLAHPCPPPEPVNDKKRIVAILP 141
           FRVTAVCGDFYIGGRQFDSLSDLI YY++CSDLLKRERLA+P  PPEPVNDKKR+VAILP
Sbjct: 110 FRVTAVCGDFYIGGRQFDSLSDLIGYYTNCSDLLKRERLAYPVAPPEPVNDKKRVVAILP 169

Query: 142 YTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVF 201
           YTKMPDTDELTFQKGDIFFVHN++GDGWLWVTAHRTGEQGMIFRDLV+ LDE IDPNTVF
Sbjct: 170 YTKMPDTDELTFQKGDIFFVHNDMGDGWLWVTAHRTGEQGMIFRDLVDHLDENIDPNTVF 229

Query: 202 DWFHPECTKNDAVDMLVKAGPVNFTISESDST 233
           DWFHP  TKN+AVDMLVK+GP +F +  SD++
Sbjct: 230 DWFHPGVTKNEAVDMLVKSGPGSFLVRPSDNS 261




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332016402|gb|EGI57315.1| Ras GTPase-activating protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383851951|ref|XP_003701494.1| PREDICTED: ras GTPase-activating protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328789390|ref|XP_003251268.1| PREDICTED: ras GTPase-activating protein 1-like isoform 1 [Apis mellifera] gi|380026365|ref|XP_003696922.1| PREDICTED: ras GTPase-activating protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|340710276|ref|XP_003393719.1| PREDICTED: ras GTPase-activating protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350423569|ref|XP_003493522.1| PREDICTED: ras GTPase-activating protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307187657|gb|EFN72629.1| Ras GTPase-activating protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328789388|ref|XP_394287.3| PREDICTED: ras GTPase-activating protein 1-like isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|307193743|gb|EFN76425.1| Ras GTPase-activating protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|194894020|ref|XP_001977990.1| GG19350 [Drosophila erecta] gi|190649639|gb|EDV46917.1| GG19350 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query235
FB|FBgn0003969 954 vap "vacuolar peduncle" [Droso 0.646 0.159 0.730 1.4e-59
UNIPROTKB|Q68CU6 539 DKFZp434N071 "Putative unchara 0.646 0.282 0.490 7e-38
UNIPROTKB|F1NCI3 388 LOC100859467 "Uncharacterized 0.646 0.391 0.483 3.9e-37
UNIPROTKB|B4DTL2 880 RASA1 "Ras GTPase-activating p 0.646 0.172 0.490 6.9e-37
UNIPROTKB|E9PGC0 881 RASA1 "Ras GTPase-activating p 0.646 0.172 0.490 6.9e-37
UNIPROTKB|F1PGT1 1024 RASA1 "Uncharacterized protein 0.646 0.148 0.490 9.9e-37
RGD|3537 1038 Rasa1 "RAS p21 protein activat 0.646 0.146 0.490 1e-36
UNIPROTKB|P50904 1038 Rasa1 "Ras GTPase-activating p 0.646 0.146 0.490 1e-36
UNIPROTKB|F1N7N8 1044 RASA1 "Ras GTPase-activating p 0.646 0.145 0.490 1e-36
UNIPROTKB|P20936 1047 RASA1 "Ras GTPase-activating p 0.646 0.145 0.490 1e-36
FB|FBgn0003969 vap "vacuolar peduncle" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 616 (221.9 bits), Expect = 1.4e-59, P = 1.4e-59
 Identities = 111/152 (73%), Positives = 125/152 (82%)

Query:    82 FRVTAVCGDFYIGGRQFXXXXXXXXXXXXXXXXXKRERLAHPCPPPEPVNDKKRIVAILP 141
             FR+TAVCGDFYIGGRQF                 KRERLA P  PPEPVNDKKR+VAILP
Sbjct:   132 FRITAVCGDFYIGGRQFISLSDLVGYYTSCSDLLKRERLAIPVAPPEPVNDKKRVVAILP 191

Query:   142 YTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVF 201
             YTKMP+TDEL+FQKGDIFFVHN++GDGWLWVTAHRTGEQGMIFR+LV+DLD +IDPNTVF
Sbjct:   192 YTKMPETDELSFQKGDIFFVHNDMGDGWLWVTAHRTGEQGMIFRELVDDLDVSIDPNTVF 251

Query:   202 DWFHPECTKNDAVDMLVKAGPVNFTISESDST 233
              WFHP CTKN+AVDMLVKAGP +F +  SD++
Sbjct:   252 PWFHPNCTKNEAVDMLVKAGPGSFLVRPSDNS 283


GO:0016319 "mushroom body development" evidence=IMP
GO:0005099 "Ras GTPase activator activity" evidence=ISS;IBA;IDA
GO:0005737 "cytoplasm" evidence=IBA;IDA
GO:0010741 "negative regulation of intracellular protein kinase cascade" evidence=IGI
GO:0040008 "regulation of growth" evidence=IMP
GO:0032320 "positive regulation of Ras GTPase activity" evidence=IBA;IDA
GO:0048149 "behavioral response to ethanol" evidence=IMP
GO:0005543 "phospholipid binding" evidence=IEA
GO:0046580 "negative regulation of Ras protein signal transduction" evidence=IBA
GO:0031235 "intrinsic to internal side of plasma membrane" evidence=IBA
UNIPROTKB|Q68CU6 DKFZp434N071 "Putative uncharacterized protein DKFZp434N071" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NCI3 LOC100859467 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B4DTL2 RASA1 "Ras GTPase-activating protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PGC0 RASA1 "Ras GTPase-activating protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PGT1 RASA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|3537 Rasa1 "RAS p21 protein activator (GTPase activating protein) 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P50904 Rasa1 "Ras GTPase-activating protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N7N8 RASA1 "Ras GTPase-activating protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P20936 RASA1 "Ras GTPase-activating protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P50904RASA1_RATNo assigned EC number0.56860.64680.1464yesN/A
P09851RASA1_BOVINNo assigned EC number0.56200.64680.1455yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
cd1178859 cd11788, SH3_RasGAP, Src Homology 3 domain of Ras 1e-33
cd1035477 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 1e-25
cd10353103 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 3e-18
smart0025284 smart00252, SH2, Src homology 2 domains 8e-14
pfam0001777 pfam00017, SH2, SH2 domain 2e-09
cd09932104 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src 5e-09
smart0032656 smart00326, SH3, Src homology 3 domains 2e-08
pfam0001847 pfam00018, SH3_1, SH3 domain 2e-08
cd1178955 cd11789, SH3_Nebulin_family_C, C-terminal Src Homo 3e-08
cd1193459 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 do 1e-07
cd0993199 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homolo 4e-07
cd0017379 cd00173, SH2, Src homology 2 (SH2) domain 5e-07
cd1034199 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src 6e-07
cd0994393 cd09943, SH2_Nck_family, Src homology 2 (SH2) doma 1e-06
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 2e-06
cd1040897 cd10408, SH2_Nck1, Src homology 2 (SH2) domain fou 7e-06
cd1178555 cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homo 9e-06
cd1034099 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homolo 1e-05
cd1184552 cd11845, SH3_Src_like, Src homology 3 domain of Sr 1e-05
cd10353103 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 2e-05
cd1035477 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 4e-05
cd1040998 cd10409, SH2_Nck2, Src homology 2 (SH2) domain fou 4e-05
cd1182652 cd11826, SH3_Abi, Src homology 3 domain of Abl Int 5e-05
cd1193358 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 5e-05
cd1179064 cd11790, SH3_Amphiphysin, Src Homology 3 domain of 7e-05
cd1036079 cd10360, SH2_Srm, Src homology 2 (SH2) domain foun 8e-05
cd1193558 cd11935, SH3_Nebulette_C, C-terminal Src Homology 8e-05
cd1194055 cd11940, SH3_ARHGEF5_19, Src homology 3 domain of 3e-04
cd1177054 cd11770, SH3_Nephrocystin, Src Homology 3 domain o 5e-04
cd1182353 cd11823, SH3_Nostrin, Src homology 3 domain of Nit 0.001
cd1034886 cd10348, SH2_Cterm_shark_like, C-terminal Src homo 0.001
cd1178355 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain 0.002
cd1192655 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain 0.002
cd1185555 cd11855, SH3_Sho1p, Src homology 3 domain of High 0.002
cd0994195 cd09941, SH2_Grb2_like, Src homology 2 domain foun 0.003
cd1187854 cd11878, SH3_Bem1p_1, First Src Homology 3 domain 0.003
cd1197261 cd11972, SH3_Abi2, Src homology 3 domain of Abl In 0.004
>gnl|CDD|212722 cd11788, SH3_RasGAP, Src Homology 3 domain of Ras GTPase-Activating Protein 1 Back     alignment and domain information
 Score =  115 bits (289), Expect = 1e-33
 Identities = 44/59 (74%), Positives = 53/59 (89%)

Query: 133 KKRIVAILPYTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDL 191
           ++R+ AILPY K+PDTDEL+FQKGDIF VHNEL DGWLWVT+ RTGE G++FRDLVE+L
Sbjct: 1   RRRVRAILPYNKVPDTDELSFQKGDIFVVHNELEDGWLWVTSLRTGESGLVFRDLVEEL 59


RasGAP, also called Ras p21 protein activator, RASA1, or p120RasGAP, is part of the GAP1 family of GTPase-activating proteins. It is a 120kD cytosolic protein containing an SH3 domain flanked by two SH2 domains at the N-terminal end, a pleckstrin homology (PH) domain, a calcium dependent phospholipid binding domain (CaLB/C2), and a C-terminal catalytic GAP domain. It stimulates the GTPase activity of normal RAS p21. It acts as a positive effector of Ras in tumor cells. It also functions as a regulator downstream of tyrosine receptors such as those of PDGF, EGF, ephrin, and insulin, among others. The SH3 domain of RasGAP is unable to bind proline-rich sequences but have been shown to interact with protein partners such as the G3BP protein, Aurora kinases, and the Calpain small subunit 1. The RasGAP SH3 domain is necessary for the downstream signaling of Ras and it also influences Rho-mediated cytoskeletal reorganization. SH3 domains are protein interaction domains that typically bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 59

>gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) Back     alignment and domain information
>gnl|CDD|198216 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) Back     alignment and domain information
>gnl|CDD|214585 smart00252, SH2, Src homology 2 domains Back     alignment and domain information
>gnl|CDD|215658 pfam00017, SH2, SH2 domain Back     alignment and domain information
>gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2 (C-SH2) domain in Phospholipase C gamma Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain of the Nebulin family of proteins Back     alignment and domain information
>gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and SH3 domain protein 1 Back     alignment and domain information
>gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2) domain found in SH2 domain Phosphatases (SHP) proteins Back     alignment and domain information
>gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain Back     alignment and domain information
>gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2 (N-SH2) domain in Phospholipase C gamma Back     alignment and domain information
>gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the Nck family Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|198271 cd10408, SH2_Nck1, Src homology 2 (SH2) domain found in Nck Back     alignment and domain information
>gnl|CDD|212719 cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains Back     alignment and domain information
>gnl|CDD|198203 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homology 2 (N-SH2) domain found in SH2 domain Phosphatases (SHP) proteins Back     alignment and domain information
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|198216 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) Back     alignment and domain information
>gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) Back     alignment and domain information
>gnl|CDD|198272 cd10409, SH2_Nck2, Src homology 2 (SH2) domain found in Nck Back     alignment and domain information
>gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins Back     alignment and domain information
>gnl|CDD|212866 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 domain of Nebulin Back     alignment and domain information
>gnl|CDD|212724 cd11790, SH3_Amphiphysin, Src Homology 3 domain of Amphiphysin and related domains Back     alignment and domain information
>gnl|CDD|198223 cd10360, SH2_Srm, Src homology 2 (SH2) domain found in Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristoylation sites (srm) Back     alignment and domain information
>gnl|CDD|212868 cd11935, SH3_Nebulette_C, C-terminal Src Homology 3 domain of Nebulette and LIM-nebulette (or Lasp2) Back     alignment and domain information
>gnl|CDD|212873 cd11940, SH3_ARHGEF5_19, Src homology 3 domain of the Rho guanine nucleotide exchange factors ARHGEF5 and ARHGEF19 Back     alignment and domain information
>gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) Back     alignment and domain information
>gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer Back     alignment and domain information
>gnl|CDD|198211 cd10348, SH2_Cterm_shark_like, C-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins Back     alignment and domain information
>gnl|CDD|212717 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains Back     alignment and domain information
>gnl|CDD|212859 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity signaling protein Sho1p Back     alignment and domain information
>gnl|CDD|199828 cd09941, SH2_Grb2_like, Src homology 2 domain found in Growth factor receptor-bound protein 2 (Grb2) and similar proteins Back     alignment and domain information
>gnl|CDD|212811 cd11878, SH3_Bem1p_1, First Src Homology 3 domain of Bud emergence protein 1 and similar domains Back     alignment and domain information
>gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 235
KOG1264|consensus 1267 99.96
KOG2996|consensus865 99.91
KOG4792|consensus293 99.9
KOG4226|consensus379 99.84
KOG4278|consensus 1157 99.67
KOG3601|consensus222 99.66
KOG4637|consensus 464 99.66
KOG4278|consensus 1157 99.64
KOG0790|consensus 600 99.54
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 99.52
cd0017394 SH2 Src homology 2 domains; Signal transduction, i 99.51
KOG0197|consensus 468 99.49
PF0001777 SH2: SH2 domain; InterPro: IPR000980 The Src homol 99.45
KOG0197|consensus 468 99.42
smart0025284 SH2 Src homology 2 domains. Src homology 2 domains 99.41
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 99.37
KOG0790|consensus 600 99.36
KOG4226|consensus379 99.34
KOG0194|consensus 474 99.26
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 99.24
KOG2199|consensus 462 99.21
KOG2996|consensus 865 99.21
KOG1118|consensus366 99.17
KOG2070|consensus 661 99.16
KOG1029|consensus1118 99.16
KOG3601|consensus 222 99.15
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 99.14
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 99.08
KOG1264|consensus 1267 99.02
KOG0162|consensus1106 99.0
KOG4225|consensus 489 98.95
smart0025284 SH2 Src homology 2 domains. Src homology 2 domains 98.91
KOG1702|consensus264 98.83
PF0001777 SH2: SH2 domain; InterPro: IPR000980 The Src homol 98.82
cd0017394 SH2 Src homology 2 domains; Signal transduction, i 98.8
KOG4348|consensus 627 98.76
KOG4637|consensus464 98.73
KOG4225|consensus489 98.69
KOG2856|consensus472 98.56
KOG2546|consensus483 98.5
KOG4348|consensus 627 98.46
KOG3655|consensus484 98.43
KOG1029|consensus 1118 98.42
KOG0515|consensus752 98.38
KOG1843|consensus473 98.27
KOG3875|consensus362 98.26
KOG2222|consensus 848 98.02
KOG1930|consensus 483 97.87
KOG3523|consensus695 97.77
KOG0609|consensus 542 97.74
KOG4773|consensus 386 97.61
KOG2528|consensus 490 97.37
KOG3632|consensus1335 97.34
KOG4575|consensus 874 97.32
KOG3557|consensus 721 97.28
KOG4792|consensus293 97.03
KOG1930|consensus483 96.98
KOG3508|consensus 932 96.87
PF14633220 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ 96.85
KOG1451|consensus812 96.75
KOG3775|consensus 482 96.65
KOG3771|consensus460 96.63
KOG0194|consensus 474 96.25
KOG4429|consensus421 96.2
KOG3697|consensus345 95.99
KOG3751|consensus622 95.9
KOG3725|consensus375 95.85
PF1460389 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. 95.32
KOG3751|consensus622 95.23
KOG0199|consensus 1039 94.3
PF0823955 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S 93.94
KOG3632|consensus 1335 93.26
smart0028763 SH3b Bacterial SH3 domain homologues. 92.18
KOG3565|consensus640 91.99
PF14633 220 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ 90.8
KOG3812|consensus 475 90.05
KOG1856|consensus1299 89.52
PRK10884206 SH3 domain-containing protein; Provisional 88.92
KOG1856|consensus1299 88.6
KOG0040|consensus 2399 84.02
KOG4566|consensus258 82.94
>KOG1264|consensus Back     alignment and domain information
Probab=99.96  E-value=2.2e-29  Score=219.66  Aligned_cols=190  Identities=29%  Similarity=0.452  Sum_probs=160.3

Q ss_pred             CeEEeecCCCCCCEEEEEEECCEEeEEEEEe-eCCe----EEcCCcccCCHHHHHHHhhhCCcc---cceeeCCccccC-
Q psy13524          1 SFLVRPSDNSPGDYSLFFHINNQIQRFRIEK-KAVR----YLMGGRTFECLDAVINRYRKEQIV---EGHTLGFPVTRI-   71 (235)
Q Consensus         1 ~FLvR~s~~~~g~~~lsv~~~~~v~h~~I~~-~~~~----~~~~~~~F~sl~eLi~~y~~~~~~---~~~~L~~p~~~~-   71 (235)
                      +||||+|+...|+|+||++.+|+|.|+||.. .+++    |+.+...|+||-+||.||+++.+.   ....|..|||++ 
T Consensus       564 tFlVReS~tFvgDytLSfwr~grv~HcRIrsk~e~gt~Kyyl~dN~vfdslY~LI~~Y~~~~Lr~aeF~m~LtePvPqp~  643 (1267)
T KOG1264|consen  564 TFLVRESETFVGDYTLSFWRSGRVQHCRIRSKMEGGTLKYYLTDNLVFDSLYALIQHYRETHLRCAEFEMRLTEPVPQPN  643 (1267)
T ss_pred             cEEEeeccccccceeeeeeECCceeeEEEEeeecCCceeEEEecchhHHHHHHHHHHHHhccccccceEEEecCCCCCCC
Confidence            6999999999999999999999999999964 3333    589999999999999999998874   467999999987 


Q ss_pred             -------------------------CCceeecc------------------eEEEEEeecCeeEeeeEEEcchhhhhhcc
Q psy13524         72 -------------------------NLGIFIPS------------------AIFRVTAVCGDFYIGGRQFDSLSDLISYY  108 (235)
Q Consensus        72 -------------------------~~~~~l~~------------------~~~~l~~~~g~~~~g~~~f~~l~~lv~~~  108 (235)
                                               .||.+|.+                  +|++|.+....+.+|...|++|.+||+||
T Consensus       644 ~He~k~W~~as~treqAE~mL~rvp~DGaFLiR~~~~~nsy~iSfr~~gkikHcRi~rdGr~fvl~t~~FesLv~lv~yY  723 (1267)
T KOG1264|consen  644 PHESKPWYHASLTREQAEDMLMRVPRDGAFLIRKREGSNSYAISFRARGKIKHCRINRDGRHFVLGTSAFESLVELVSYY  723 (1267)
T ss_pred             cccCCccccccccHHHHHHHHhhCccCcceEEEeccCCceEEEEEEEcCcEeEEEEccCceEEEeccHHHHHHHHHHHHH
Confidence                                     45555543                  89999998888889977799999999999


Q ss_pred             ccCCchhhcccccCCCCCC---------------------------CCCCCccEEEEeeccCCCCCCCCcccCCCCEEEE
Q psy13524        109 SSCSDLLKRERLAHPCPPP---------------------------EPVNDKKRIVAILPYTKMPDTDELTFQKGDIFFV  161 (235)
Q Consensus       109 ~~~~~~~~~~~~~~p~~~~---------------------------~~~~~~~~~~a~~~~~~~~~~~eL~~~~gd~i~v  161 (235)
                      .+.+.... .++..|+.+.                           .+..+...++|+|+|.| ..++||+|.+|.+|++
T Consensus       724 ~k~~lyR~-mkLr~PVnee~l~~~~~e~d~~a~~d~~r~pg~yme~n~~~~~vt~kAL~~Yka-~r~DELSFpk~aiItn  801 (1267)
T KOG1264|consen  724 EKHPLYRK-MKLRYPVNEELLERYNTERDINALYDVSRMPGDYMEINPSMPQVTVKALYDYKA-KRSDELSFPKGAIITN  801 (1267)
T ss_pred             hcChhhhc-ccccCcCCHHHHHHhhhhcccccccccccCCCCccccCccccchhhhhhhcccc-CCcccccccccceeEe
Confidence            98766554 8888887520                           01113356899999999 8999999999999999


Q ss_pred             eeccCCCeeEEEecCCCceeEEeCCcEEeccC
Q psy13524        162 HNELGDGWLWVTAHRTGEQGMIFRDLVEDLDE  193 (235)
Q Consensus       162 ~~~~~~~w~w~~~~~~~~~G~~P~~~v~~~~~  193 (235)
                      +.+..+|| |.|...+...+|||+|||+.+..
T Consensus       802 v~keeg~w-WrGdYGg~iq~wfPsnyVeei~~  832 (1267)
T KOG1264|consen  802 VSKEEGGW-WRGDYGGRIQQWFPSNYVEEIST  832 (1267)
T ss_pred             eeccCCce-eecccccceeeeccHHHhhhhcc
Confidence            99999999 99999666789999999998753



>KOG2996|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG4637|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>smart00252 SH2 Src homology 2 domains Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>smart00252 SH2 Src homology 2 domains Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] Back     alignment and domain information
>cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG4637|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>KOG1930|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG1930|consensus Back     alignment and domain information
>KOG3508|consensus Back     alignment and domain information
>PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>KOG4429|consensus Back     alignment and domain information
>KOG3697|consensus Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>KOG3725|consensus Back     alignment and domain information
>PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>smart00287 SH3b Bacterial SH3 domain homologues Back     alignment and domain information
>KOG3565|consensus Back     alignment and domain information
>PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information
>KOG1856|consensus Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG1856|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>KOG4566|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
2gqi_A71 Solution Structure Of The Sh3 Domain Of Human Ras G 2e-19
2j05_A65 Crystal Structure Of The Rasgap Sh3 Domain At 1.5 A 7e-18
4fss_A62 Crystal Structure Of A Ras P21 Protein Activator (R 7e-18
2gsb_A119 Solution Structure Of The Second Sh2 Domain Of Huma 9e-16
3i35_A60 Human Sh3 Domain Of Protein Lasp1 Length = 60 2e-05
2ci9_A102 Nck1 Sh2-Domain In Complex With A Dodecaphosphopept 2e-04
2ci8_A99 Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomple 2e-04
2b3o_A 532 Crystal Structure Of Human Tyrosine Phosphatase Shp 2e-04
3ps5_A 595 Crystal Structure Of The Full-Length Human Protein 2e-04
>pdb|2GQI|A Chain A, Solution Structure Of The Sh3 Domain Of Human Ras Gtpase- Activating Protein 1 Length = 71 Back     alignment and structure

Iteration: 1

Score = 92.0 bits (227), Expect = 2e-19, Method: Composition-based stats. Identities = 39/58 (67%), Positives = 49/58 (84%) Query: 134 KRIVAILPYTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDL 191 +R+ AILPYTK+PDTDE++F KGD+F VHNEL DGW+WVT RT EQG+I DLVE++ Sbjct: 8 RRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEV 65
>pdb|2J05|A Chain A, Crystal Structure Of The Rasgap Sh3 Domain At 1.5 Angstrom Resolution Length = 65 Back     alignment and structure
>pdb|4FSS|A Chain A, Crystal Structure Of A Ras P21 Protein Activator (Rasa1) From Homo Sapiens At 2.25 A Resolution Length = 62 Back     alignment and structure
>pdb|2GSB|A Chain A, Solution Structure Of The Second Sh2 Domain Of Human Ras Gtpase-Activating Protein 1 Length = 119 Back     alignment and structure
>pdb|3I35|A Chain A, Human Sh3 Domain Of Protein Lasp1 Length = 60 Back     alignment and structure
>pdb|2CI9|A Chain A, Nck1 Sh2-Domain In Complex With A Dodecaphosphopeptide From Epec Protein Tir Length = 102 Back     alignment and structure
>pdb|2CI8|A Chain A, Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomplexed Length = 99 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 2e-23
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 3e-22
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 3e-20
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 1e-04
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 5e-20
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 2e-08
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 5e-20
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 9e-17
3gqi_B226 Phospholipase C-gamma-1; phosphorylated kinase, PY 2e-15
3gqi_B226 Phospholipase C-gamma-1; phosphorylated kinase, PY 2e-14
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 3e-15
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 1e-12
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 1e-05
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 9e-15
1gri_A 217 Growth factor bound protein 2; SH2, SH3, signal tr 4e-12
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 1e-06
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 1e-14
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 1e-14
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 3e-14
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 3e-05
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 1e-13
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 5e-06
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 2e-13
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 3e-09
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 2e-13
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 1e-04
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 2e-13
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 6e-09
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 3e-13
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 7e-06
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 3e-13
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 6e-13
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 5e-06
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 1e-12
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 1e-08
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 1e-12
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-07
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 4e-05
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 1e-12
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 5e-08
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 2e-12
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 2e-07
2dly_A121 FYN-related kinase; BRK family kinase, structural 2e-12
2dly_A121 FYN-related kinase; BRK family kinase, structural 1e-08
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 3e-12
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 2e-11
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 4e-08
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 1e-05
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 5e-12
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 7e-05
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 7e-05
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 6e-12
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 6e-12
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 2e-08
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 7e-12
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 2e-07
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 7e-12
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 3e-07
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 8e-12
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 8e-12
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 5e-06
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 1e-11
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 1e-11
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 1e-11
2aug_A126 Growth factor receptor-bound protein 14; phosphory 2e-11
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 3e-11
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 3e-11
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 5e-11
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 6e-08
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 8e-11
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 4e-07
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 1e-10
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 1e-10
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 1e-10
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 2e-10
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 2e-10
2cuc_A70 SH3 domain containing ring finger 2; structural ge 3e-10
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 4e-10
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 8e-08
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 6e-10
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 7e-07
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 1e-09
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 1e-09
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 1e-09
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 2e-09
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 2e-09
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 2e-09
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 3e-09
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 3e-09
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 3e-09
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 1e-05
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 6e-09
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 2e-07
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 9e-09
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 9e-09
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 1e-08
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 1e-08
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 1e-08
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 1e-08
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 1e-08
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 1e-08
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 3e-06
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 2e-08
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 2e-08
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 2e-08
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 4e-05
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 2e-08
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 3e-08
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 4e-08
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 6e-08
3hhm_B 373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 7e-04
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 7e-08
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 4e-07
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 9e-08
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 2e-05
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 9e-08
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 9e-08
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 1e-07
2vif_A141 Suppressor of cytokine signalling 6; growth regula 1e-07
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 1e-07
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 1e-07
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 1e-07
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 2e-07
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 2e-07
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-05
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 3e-07
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 3e-07
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 3e-07
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 3e-05
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 3e-07
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 6e-07
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 6e-07
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 7e-07
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 7e-07
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 1e-06
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 1e-06
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 1e-06
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 1e-06
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 3e-06
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 1e-06
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 1e-06
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 2e-06
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 4e-05
2dil_A69 Proline-serine-threonine phosphatase-interacting p 2e-06
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 2e-06
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 2e-06
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 2e-06
1awj_A77 ITK; transferase, regulatory intramolecular comple 3e-06
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 4e-06
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 4e-06
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 4e-06
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 4e-06
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 5e-06
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 5e-06
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 6e-06
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 6e-06
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 6e-06
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 2e-05
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 7e-06
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 8e-06
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 8e-06
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 9e-06
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 9e-06
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 1e-05
1wxb_A68 Epidermal growth factor receptor pathway substrate 1e-05
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 1e-05
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 1e-05
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 1e-05
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 2e-05
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 2e-05
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 2e-05
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 2e-05
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 2e-05
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 2e-05
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 2e-05
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 3e-05
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 3e-05
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 3e-05
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 4e-05
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 5e-05
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 5e-05
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 5e-05
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 5e-05
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 5e-05
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 6e-05
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 6e-05
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 8e-05
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 8e-05
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 9e-05
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 9e-05
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 9e-05
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 9e-05
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 9e-05
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 9e-05
1i07_A60 Epidermal growth factor receptor kinase substrate 1e-04
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 1e-04
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 1e-04
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 1e-04
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 1e-04
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 1e-04
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 1e-04
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 1e-04
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 1e-04
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 2e-04
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 2e-04
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 2e-04
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 2e-04
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 2e-04
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 2e-04
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 2e-04
3u23_A65 CD2-associated protein; structural genomics, struc 2e-04
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 2e-04
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 2e-04
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 3e-04
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 3e-04
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 3e-04
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 3e-04
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 3e-04
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 4e-04
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 4e-04
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 5e-04
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 5e-04
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 5e-04
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 5e-04
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 5e-04
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 6e-04
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 6e-04
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 6e-04
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 6e-04
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 7e-04
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 8e-04
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 8e-04
3maz_A125 Signal-transducing adaptor protein 1; modular doma 8e-04
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 9e-04
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 9e-04
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 9e-04
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 Back     alignment and structure
 Score = 88.6 bits (220), Expect = 2e-23
 Identities = 39/59 (66%), Positives = 50/59 (84%)

Query: 133 KKRIVAILPYTKMPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDL 191
           ++R+ AILPYTK+PDTDE++F KGD+F VHNEL DGW+WVT  RT EQG+I  DLVE++
Sbjct: 5   RRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEV 63


>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 Back     alignment and structure
>3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 109 Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Length = 105 Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Length = 128 Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Length = 104 Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Length = 103 Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Length = 164 Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Length = 141 Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query235
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 99.95
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 99.95
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.95
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 99.89
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.93
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.93
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 99.91
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 99.88
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 99.87
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.85
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.85
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 99.85
4fbn_A246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 99.84
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.84
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.83
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.82
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.82
1gri_A 217 Growth factor bound protein 2; SH2, SH3, signal tr 99.81
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 99.8
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 99.79
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 99.79
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.78
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 99.76
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.75
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 99.74
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 99.74
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 99.73
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 99.72
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 99.72
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 99.71
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 99.71
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 99.7
2dly_A121 FYN-related kinase; BRK family kinase, structural 99.7
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 99.7
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.7
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 99.69
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 99.69
3maz_A125 Signal-transducing adaptor protein 1; modular doma 99.69
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 99.69
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 99.69
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 99.69
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 99.69
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 99.69
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 99.68
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 99.68
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 99.68
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.68
2aug_A126 Growth factor receptor-bound protein 14; phosphory 99.68
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 99.68
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 99.67
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 99.67
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 99.67
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 99.67
2lnw_A122 VAV-2, guanine nucleotide exchange factor VAV2; si 99.67
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 99.66
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 99.66
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.65
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 99.65
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 99.65
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 99.64
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 99.64
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 99.64
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.63
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 99.63
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 99.63
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 99.62
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 99.62
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 99.62
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 99.62
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 99.61
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 99.6
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 99.59
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 99.58
2vif_A141 Suppressor of cytokine signalling 6; growth regula 99.58
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 99.57
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 99.57
4fbn_A246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 99.56
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 99.56
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 99.56
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 99.56
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 99.56
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 99.56
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 99.56
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 99.56
1uti_A58 GRB2-related adaptor protein 2; signaling protein 99.56
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 99.56
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 99.55
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 99.55
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 99.55
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 99.55
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 99.55
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 99.55
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 99.54
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 99.54
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 99.54
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 99.54
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 99.54
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 99.54
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 99.54
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 99.54
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 99.53
2j6f_A62 CD2-associated protein; metal-binding, immune resp 99.53
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 99.53
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 99.53
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 99.53
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 99.53
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 99.53
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 99.53
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 99.53
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 99.53
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 99.52
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 99.52
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.52
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 99.52
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 99.52
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 99.52
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 99.52
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 99.52
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 99.52
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 99.52
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 99.52
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 99.52
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 99.51
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 99.51
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 99.51
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 99.51
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 99.51
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 99.51
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 99.51
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 99.51
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 99.51
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 99.51
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 99.51
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 99.51
1i07_A60 Epidermal growth factor receptor kinase substrate 99.51
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 99.5
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 99.5
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 99.5
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 99.5
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 99.5
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 99.5
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 99.5
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 99.5
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 99.5
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 99.5
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 99.5
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 99.5
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 99.5
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.5
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 99.5
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 99.5
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 99.49
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 99.49
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 99.49
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 99.49
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 99.49
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 99.49
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 99.49
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 99.49
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 99.49
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.49
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 99.49
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 99.49
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 99.49
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 99.48
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 99.48
2da9_A70 SH3-domain kinase binding protein 1; structural ge 99.48
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 99.48
3u23_A65 CD2-associated protein; structural genomics, struc 99.48
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 99.48
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 99.48
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 99.48
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 99.48
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 99.48
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 99.48
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 99.48
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 99.48
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 99.48
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 99.47
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 99.47
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 99.47
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 99.47
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 99.47
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 99.47
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 99.47
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 99.47
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.47
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 99.47
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 99.47
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 99.47
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 99.47
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 99.46
2dil_A69 Proline-serine-threonine phosphatase-interacting p 99.46
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 99.46
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 99.46
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 99.46
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 99.46
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 99.45
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 99.45
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 99.45
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 99.45
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 99.45
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 99.45
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.45
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 99.45
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 99.45
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 99.45
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 99.45
1wxb_A68 Epidermal growth factor receptor pathway substrate 99.45
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 99.44
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 99.44
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 99.44
2cuc_A70 SH3 domain containing ring finger 2; structural ge 99.44
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 99.44
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 99.44
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 99.44
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.44
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 99.44
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.44
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 99.43
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 99.43
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.43
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 99.43
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 99.43
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.43
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 99.43
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 99.42
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 99.42
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 99.42
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.41
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.41
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 99.4
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 99.4
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 99.39
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 99.39
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 99.38
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 99.37
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.36
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 99.35
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 99.35
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.35
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 99.35
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 99.35
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.34
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 99.34
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 99.34
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 99.33
1awj_A77 ITK; transferase, regulatory intramolecular comple 99.33
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 99.33
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.31
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 99.29
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 99.28
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 99.28
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 99.28
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 99.28
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 99.25
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 99.23
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 99.22
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.2
2dly_A121 FYN-related kinase; BRK family kinase, structural 99.2
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.19
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 99.18
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 99.16
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 99.15
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 99.11
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 99.11
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 99.1
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 99.1
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.08
2xp1_A178 SPT6; transcription, IWS1, histone chaperone, mRNA 99.08
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 99.08
1u3o_A82 Huntingtin-associated protein-interacting protein; 99.08
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 99.08
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 99.07
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.06
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 99.06
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 99.06
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 99.04
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 99.04
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 99.03
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 99.03
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.02
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 99.02
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 99.02
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.02
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 99.02
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 99.0
2lnw_A122 VAV-2, guanine nucleotide exchange factor VAV2; si 98.99
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 98.99
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 98.99
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 98.99
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 98.98
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 98.98
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 98.98
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 98.98
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 98.97
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 98.97
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 98.96
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 98.96
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 98.95
2vif_A141 Suppressor of cytokine signalling 6; growth regula 98.94
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 98.94
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 98.94
2aug_A126 Growth factor receptor-bound protein 14; phosphory 98.94
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 98.93
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 98.93
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 98.93
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 98.93
2izv_A 187 Suppressor of cytokine signaling 4; signal transdu 98.91
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 98.91
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.89
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 98.89
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 98.88
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 98.38
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 98.86
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 98.85
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 98.84
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 98.84
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 98.84
3maz_A125 Signal-transducing adaptor protein 1; modular doma 98.81
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 98.79
2bbu_A 164 Suppressor of cytokine signaling 3; SH2 domain, ex 98.79
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 98.78
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 98.74
1kjw_A 295 Postsynaptic density protein 95; protein-protein i 98.73
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 98.63
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 98.59
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 98.58
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 98.36
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.31
3kfv_A 308 Tight junction protein ZO-3; structural genomics c 98.27
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 98.24
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.2
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 98.19
3tvt_A 292 Disks large 1 tumor suppressor protein; DLG, SRC-h 98.18
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.15
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 98.08
3or8_A197 Transcription elongation factor SPT6; SH2, CTD bin 97.89
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 97.78
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 97.74
1uur_A473 Stata protein, STAT protein; transcription activat 97.25
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 97.07
3or8_A197 Transcription elongation factor SPT6; SH2, CTD bin 96.78
1yvl_A683 Signal transducer and activator of transcription 1 96.6
1bf5_A 575 Signal transducer and activator of transcription 1 96.55
1y1u_A585 Signal transducer and activator of transcription; 96.17
1bg1_A 596 Protein (transcription factor STAT3B); protein-DNA 95.87
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 95.47
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 94.32
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_058 93.12
2kt8_A76 Probable surface protein; SH3 family, structural g 92.79
1uur_A473 Stata protein, STAT protein; transcription activat 90.82
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 90.0
3psi_A1219 Transcription elongation factor SPT6; nucleus; 3.3 89.62
1wfw_A74 Kalirin-9A; SH3 domain, neuron-specific GDP/GTP ex 89.49
2kq8_A70 Cell WALL hydrolase; GFT protein structure, NESG, 89.32
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 87.93
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 87.73
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 86.62
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 83.18
3bux_B329 E3 ubiquitin-protein ligase CBL; TKB, signal trans 80.91
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
Probab=99.95  E-value=2.4e-27  Score=180.58  Aligned_cols=126  Identities=21%  Similarity=0.464  Sum_probs=107.2

Q ss_pred             CeEEeecCCCCCCEEEEEEECCE---EeEEEEEe---e-CC----eEEcCCcccCCHHHHHHHhhhCCcccceeeCCccc
Q psy13524          1 SFLVRPSDNSPGDYSLFFHINNQ---IQRFRIEK---K-AV----RYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVT   69 (235)
Q Consensus         1 ~FLvR~s~~~~g~~~lsv~~~~~---v~h~~I~~---~-~~----~~~~~~~~F~sl~eLi~~y~~~~~~~~~~L~~p~~   69 (235)
                      +||||+| +.+|.|+|||+.++.   |+||+|.+   . ++    .|..+...|+|+.+||+||+.+++ ..+.|..|++
T Consensus        37 ~FLVR~S-~~~g~y~LSv~~~~~~~~v~H~~I~~~~~~~~g~~~~~~~~~~~~F~sl~eLv~~y~~~~~-~~~~L~~P~~  114 (174)
T 3qwx_X           37 TFLMRDS-SRPGEYSLTVREADEGNAVCHYLIERGEPKEDGTAAAGVKIANQSFPDIPALLNHFKMRVL-TEASLLAAYK  114 (174)
T ss_dssp             EEEEEEC-SSTTCEEEEEECCSSSSCEEEEEEEECCCCTTSSSCCCEEETTEEESSHHHHHHHTTSSCS-SSCCCCEECC
T ss_pred             eEEEEec-CCCCCEEEEEEECCCCCceEEEEEEeccCCCCCcccceEEECCeecCcHHHHhhhhhcCcc-cccccccccc
Confidence            5999999 889999999999998   99999987   3 22    476678999999999999999874 4455555553


Q ss_pred             cCCCceeecceEEEEEeecCeeEeeeEEEcchhhhhhccccCCchhhcccccCCCCCCCCCCCccEEEEeeccCCCCCCC
Q psy13524         70 RINLGIFIPSAIFRVTAVCGDFYIGGRQFDSLSDLISYYSSCSDLLKRERLAHPCPPPEPVNDKKRIVAILPYTKMPDTD  149 (235)
Q Consensus        70 ~~~~~~~l~~~~~~l~~~~g~~~~g~~~f~~l~~lv~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~a~~~~~~~~~~~  149 (235)
                      +                                                        +    ....++|+|+|.+ ..++
T Consensus       115 ~--------------------------------------------------------p----~~~~~~alydy~~-~~~~  133 (174)
T 3qwx_X          115 K--------------------------------------------------------P----IIEVVVGTFKFTG-ERET  133 (174)
T ss_dssp             C--------------------------------------------------------C----CSEEEEESSCBCC-SSTT
T ss_pred             c--------------------------------------------------------c----cccEEEEecCccc-CCCC
Confidence            2                                                        1    2357899999999 8999


Q ss_pred             CcccCCCCEEEEeeccCCCeeEEEecCCCceeEEeCCcEEe
Q psy13524        150 ELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVED  190 (235)
Q Consensus       150 eL~~~~gd~i~v~~~~~~~w~w~~~~~~~~~G~~P~~~v~~  190 (235)
                      +|+|++||+|.|+++.+++| |.++..+|+.|+||+|||+.
T Consensus       134 eLsf~~Gd~i~v~~~~~~~W-w~g~~~~g~~G~~P~nyv~~  173 (174)
T 3qwx_X          134 DLPFEQGERLEILSKTNQDW-WEARNALGTTGLVPANYVQI  173 (174)
T ss_dssp             BCCBCTTCEEEEEECCSSSE-EEEECTTCCEEEEEGGGEEE
T ss_pred             ccccccCCEEEEEEccCCCe-EEEEECCCCEEEEChHHEEe
Confidence            99999999999999999999 99996699999999999974



>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Back     alignment and structure
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Back     alignment and structure
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 235
d2shpa2109 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma 3e-11
d2shpa2109 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma 2e-07
d1spka_72 b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI 4e-11
d1r1qa_97 d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA 5e-11
d1r1qa_97 d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA 0.002
d1jwoa_97 d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho 9e-11
d1jwoa_97 d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho 6e-06
d2qmsa1113 d.93.1.1 (A:420-532) Growth factor receptor-bound 1e-10
d2fcia1105 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B 1e-10
d2fcia1105 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B 2e-09
d1jyra_96 d.93.1.1 (A:) Growth factor receptor-bound protein 2e-10
d1jyra_96 d.93.1.1 (A:) Growth factor receptor-bound protein 0.001
d1mila_104 d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap 3e-10
d1mila_104 d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap 3e-04
d1nrva_105 d.93.1.1 (A:) Growth factor receptor-bound protein 7e-10
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 2e-09
d2oq1a1130 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 3e-09
d2oq1a1130 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 2e-05
d1rjaa_100 d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu 3e-09
d1rjaa_100 d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu 1e-06
d1d4ta_104 d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap 3e-09
d2eyva1109 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo 4e-09
d1k9aa2101 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( 5e-09
d1k9aa2101 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( 2e-05
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 3e-08
d1opka2101 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M 3e-08
d1fu6a_111 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 3e-08
d1fu6a_111 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 2e-04
d1lkka_105 d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo 5e-08
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 5e-08
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 7e-08
d2shpa3108 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu 7e-08
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 8e-08
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 8e-08
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-07
d1rpya_86 d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor 1e-07
d2c9wa2103 d.93.1.1 (A:32-134) Suppressor of cytokine signali 1e-07
d2izva2112 d.93.1.1 (A:274-385) Suppressor of cytokine signal 2e-07
d1qcfa2103 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H 2e-07
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 3e-07
d1qada_107 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 5e-07
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 6e-07
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 7e-07
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 7e-07
d1i3za_103 d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat 8e-07
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 8e-07
d1a81a1129 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom 9e-07
d1a81a1129 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom 2e-05
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 9e-07
d1uffa_93 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-06
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 1e-06
d1wiea_96 b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human 1e-06
d1o48a_106 d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s 1e-06
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 1e-06
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 2e-06
d1blja_114 d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou 2e-06
d1xa6a2141 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom 2e-06
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 3e-06
d2oq1a2124 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 5e-06
d2oq1a2124 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 3e-05
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 7e-06
d2cs0a1106 d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai 8e-06
d2cs0a1106 d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai 4e-05
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 8e-06
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 9e-06
d1ue9a_80 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-05
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-05
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 1e-05
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 1e-05
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 1e-05
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 2e-05
d1uhca_79 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 2e-05
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 2e-05
d1g83a2104 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H 2e-05
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 3e-05
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 3e-05
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 5e-05
d1a81a2125 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H 6e-05
d1luia_108 d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou 7e-05
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 9e-05
d2v1ra167 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe 3e-04
d1uura3131 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium 3e-04
d2rn8a153 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus 7e-04
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 0.001
d1bb9a_83 b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu 0.001
d1i1ja_106 b.34.2.1 (A:) Melanoma inhibitory activity protein 0.001
d1ng2a158 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic 0.002
d1kjwa196 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu 0.003
d1t0ha_96 b.34.2.1 (A:) SH3-like domain of the L-type calciu 0.003
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: SH2-like
superfamily: SH2 domain
family: SH2 domain
domain: Tyrosine phoshatase shp-2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 56.6 bits (136), Expect = 3e-11
 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 1/70 (1%)

Query: 1  SFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKA-VRYLMGGRTFECLDAVINRYRKEQIV 59
          SFL RPS ++PGD +L    N  +   +I+       L GG  F  L  ++  Y +    
Sbjct: 27 SFLARPSKSNPGDLTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQ 86

Query: 60 EGHTLGFPVT 69
               G  + 
Sbjct: 87 LKEKNGDVIE 96


>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query235
d1jwoa_97 Csk homologous kinase Chk {Human (Homo sapiens) [T 99.79
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 99.77
d1k9aa2101 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.76
d2oq1a1130 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.75
d1a81a1129 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 99.74
d1opka2101 Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 99.74
d2fcia1105 Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 99.72
d1i3za_103 Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus 99.71
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 99.71
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 99.71
d1a81a2125 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 99.7
d2oq1a2124 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.7
d1mila_104 Shc adaptor protein {Human (Homo sapiens) [TaxId: 99.68
d1d4ta_104 The Xlp protein Sap {Human (Homo sapiens) [TaxId: 99.68
d2qmsa1113 Growth factor receptor-bound protein 7 {Human (Hom 99.68
d1lkka_105 p56-lck tyrosine kinase {Human (Homo sapiens) [Tax 99.67
d2shpa2109 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 99.66
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 99.66
d1o48a_106 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.66
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 99.65
d1blja_114 P55 Blk protein tyrosine kinase {Mouse (Mus muscul 99.65
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.65
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.64
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.64
d1jyra_96 Growth factor receptor-bound protein 2 (GRB2) {Hum 99.63
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 99.63
d1g83a2104 Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 99.63
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 99.62
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.62
d2eyva1109 Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 99.62
d1r1qa_97 GRB2-related adaptor protein 2 (MONA, GRID) {Mouse 99.61
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.61
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 99.61
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.6
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.59
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 99.59
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.58
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.58
d2izva2112 Suppressor of cytokine signaling 4, SOCS-4 {Human 99.58
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.58
d1qada_107 Phosphatidylinositol 3-kinase, p85-alpha subunit { 99.58
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.57
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.57
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 99.57
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.57
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 99.56
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 99.55
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 99.55
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 99.55
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.55
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 99.54
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.53
d2shpa3108 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 99.53
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.53
d2cs0a1106 Hematopoietic SH2 domain containing protein HSH2D 99.53
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 99.52
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 99.52
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 99.52
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 99.51
d1rpya_86 Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI 99.5
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 99.5
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.5
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.5
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 99.5
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 99.49
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 99.48
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.48
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.47
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.44
d1fu6a_111 Phosphatidylinositol 3-kinase, p85-alpha subunit { 99.44
d2c9wa2103 Suppressor of cytokine signaling 2, SOCS-2 {Human 99.43
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 99.42
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 99.42
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 99.4
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 99.34
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.33
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 99.33
d1xa6a2141 Beta-chimaerin, N-terminal domain {Human (Homo sap 99.22
d1d4ta_104 The Xlp protein Sap {Human (Homo sapiens) [TaxId: 99.17
d1lkka_105 p56-lck tyrosine kinase {Human (Homo sapiens) [Tax 99.16
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 99.14
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 99.14
d1opka2101 Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 99.13
d1jwoa_97 Csk homologous kinase Chk {Human (Homo sapiens) [T 99.13
d1g83a2104 Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 99.12
d1r1qa_97 GRB2-related adaptor protein 2 (MONA, GRID) {Mouse 99.1
d2fcia1105 Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 99.1
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 99.1
d1k9aa2101 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.09
d1o48a_106 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.09
d1blja_114 P55 Blk protein tyrosine kinase {Mouse (Mus muscul 99.08
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 99.08
d1rpya_86 Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI 99.07
d1i3za_103 Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus 99.07
d1fu6a_111 Phosphatidylinositol 3-kinase, p85-alpha subunit { 99.06
d1jyra_96 Growth factor receptor-bound protein 2 (GRB2) {Hum 99.06
d2shpa2109 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 99.04
d2c9wa2103 Suppressor of cytokine signaling 2, SOCS-2 {Human 99.03
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 99.02
d2qmsa1113 Growth factor receptor-bound protein 7 {Human (Hom 99.02
d1qada_107 Phosphatidylinositol 3-kinase, p85-alpha subunit { 99.02
d2oq1a2124 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.02
d2izva2112 Suppressor of cytokine signaling 4, SOCS-4 {Human 98.99
d1a81a2125 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 98.97
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 98.96
d2cs0a1106 Hematopoietic SH2 domain containing protein HSH2D 98.96
d1mila_104 Shc adaptor protein {Human (Homo sapiens) [TaxId: 98.96
d1xa6a2141 Beta-chimaerin, N-terminal domain {Human (Homo sap 98.92
d1uura3131 STAT homologue {Dictyostelium discoideum [TaxId: 4 98.29
d1bg1a3141 STAT3b {Mouse (Mus musculus) [TaxId: 10090]} 98.09
d1a81a1129 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 96.7
d2oq1a1130 Tyrosine-protein kinase zap-70 {Human (Homo sapien 96.55
d1ri9a_77 Fyn-binding protein (T-cell adapter protein adap) 96.12
d2shpa3108 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 91.98
d2eyva1109 Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 88.74
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: SH2-like
superfamily: SH2 domain
family: SH2 domain
domain: Csk homologous kinase Chk
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.79  E-value=1.7e-19  Score=121.88  Aligned_cols=70  Identities=24%  Similarity=0.373  Sum_probs=65.3

Q ss_pred             CeEEeecCCCCCCEEEEEEECCEEeEEEEEeeCCeE-EcCCcccCCHHHHHHHhhhCCcccceeeCCcccc
Q psy13524          1 SFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRY-LMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTR   70 (235)
Q Consensus         1 ~FLvR~s~~~~g~~~lsv~~~~~v~h~~I~~~~~~~-~~~~~~F~sl~eLi~~y~~~~~~~~~~L~~p~~~   70 (235)
                      +||||+|++.+|.|+|||+.+++|+||+|.+.+++| +.++..|+||.+||+||+++++++.++|..||+|
T Consensus        27 ~FLVR~S~~~~g~~vLSv~~~~~v~H~~I~~~~~~~~~~~~~~F~sl~~LI~~y~~~~~~L~~~L~~P~~k   97 (97)
T d1jwoa_          27 LFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRK   97 (97)
T ss_dssp             CEEEEECSSSTTCEEEEEEETTEEEEEEEEESSSEESSTTSCCBSCHHHHHHHHHHCCTTSSSCCCCBCCC
T ss_pred             eEEEEecCCCCccEEEEEEecCceEEEEEEEcCCcEEecCCcccCCHHHHHHHHhhCCCCCCccCCccCcC
Confidence            699999999999999999999999999998877776 7778899999999999999999999999999975



>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure