Diaphorina citri psyllid: psy13529


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MAILVLLVTNRAYGPQANSSYLLLPPRAAQDGMLDILREATKRDCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG
cHHHHHHHHccccccccccccccccHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHccHHHHHHHHHcc
MAILVLLVTNRAYGPQANSSYLLLPPRAAQDGMLDILREATKRDCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAILVLLVTNRAYGPQANSSYLLLPPRAAQDGMLDILREATKRDCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Usher syndrome type-1G protein homolog Required for normal development and maintenance of cochlear hair cell bundles. Anchoring/scaffolding protein that is a part of the functional network formed by USH1C, USH1G, CDH23 and MYO7A that mediates mechanotransduction in cochlear hair cells. Required for normal hearing.confidentQ80T11
Usher syndrome type-1G protein Required for normal development and maintenance of cochlear hair cell bundles. Anchoring/scaffolding protein that is a part of the functional network formed by USH1C, USH1G, CDH23 and MYO7A that mediates mechanotransduction in cochlear hair cells. Required for normal hearing.confidentQ495M9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0050957 [BP]equilibrioceptionprobableGO:0032501, GO:0050885, GO:0044707, GO:0050877, GO:0007600, GO:0008150, GO:0050905, GO:0044699, GO:0003008
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005769 [CC]early endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0045494 [BP]photoreceptor cell maintenanceprobableGO:0032501, GO:0044707, GO:0043954, GO:0071840, GO:0009987, GO:0007601, GO:0007600, GO:0050953, GO:0044763, GO:0016043, GO:0050877, GO:0008150, GO:0044699, GO:0003008

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 2-75
View the alignment between query and template
View the model in PyMOL