Psyllid ID: psy13529


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MAILVLLVTNRAYGPQANSSYLLLPPRAAQDGMLDILREATKRDCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG
cHHHHHHHHcccccccccccccccHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHcc
cEEEEEEEEcccccccccccEEEccHHHHHccHHHHHHHHHHHHHcccccccccHHHHHHHHccHHHHHHHHccc
MAILVLLVTNraygpqanssylllppraaqDGMLDILREATKrdcnakdedgmtpTLWAAFQGNLEALRLLVGRG
MAILVLLVTnraygpqanssylllpPRAAQDGMLDILREATKRDCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG
MAILVLLVTNRAYGPQANSSYLLLPPRAAQDGMLDILREATKRDCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG
**ILVLLVTNRAYGPQANSSYLLLPPRAAQDGMLDILRE*************MTPTLWAAFQGNLEALRLLV***
MAILVLLVTNRAYGPQANSSYLLLPPRAAQDGMLDILREATKRDCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG
MAILVLLVTNRAYGPQANSSYLLLPPRAAQDGMLDILREATKRDCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG
MAILVLLVTNRAYGPQANSSYLLLPPRAAQDGMLDILREATKRDCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAILVLLVTNRAYGPQANSSYLLLPPRAAQDGMLDILREATKRDCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query75 2.2.26 [Sep-21-2011]
Q80T11 461 Usher syndrome type-1G pr yes N/A 0.653 0.106 0.693 2e-14
Q495M9 461 Usher syndrome type-1G pr yes N/A 0.653 0.106 0.693 2e-14
Q8K3X6 423 Ankyrin repeat and SAM do no N/A 0.653 0.115 0.632 1e-11
Q8N8V4 417 Ankyrin repeat and SAM do no N/A 0.653 0.117 0.632 1e-11
>sp|Q80T11|USH1G_MOUSE Usher syndrome type-1G protein homolog OS=Mus musculus GN=Ush1g PE=1 SV=1 Back     alignment and function desciption
 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 44/49 (89%)

Query: 27 RAAQDGMLDILREATKRDCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG 75
          RAA+DG L++L+EAT+++ NA DEDGMTPTLWAA+ GNLE+LRL+V RG
Sbjct: 7  RAARDGYLELLKEATRKELNAPDEDGMTPTLWAAYHGNLESLRLIVSRG 55




Required for normal development and maintenance of cochlear hair cell bundles. Anchoring/scaffolding protein that is a part of the functional network formed by USH1C, USH1G, CDH23 and MYO7A that mediates mechanotransduction in cochlear hair cells. Required for normal hearing.
Mus musculus (taxid: 10090)
>sp|Q495M9|USH1G_HUMAN Usher syndrome type-1G protein OS=Homo sapiens GN=USH1G PE=1 SV=1 Back     alignment and function description
>sp|Q8K3X6|ANS4B_MOUSE Ankyrin repeat and SAM domain-containing protein 4B OS=Mus musculus GN=Anks4b PE=1 SV=1 Back     alignment and function description
>sp|Q8N8V4|ANS4B_HUMAN Ankyrin repeat and SAM domain-containing protein 4B OS=Homo sapiens GN=ANKS4B PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query75
328706555 481 PREDICTED: Usher syndrome type-1G protei 0.653 0.101 0.795 5e-17
321477337 472 hypothetical protein DAPPUDRAFT_305682 [ 0.653 0.103 0.755 4e-16
27001161977 hypothetical protein TcasGA2_TC005663 [T 0.653 0.636 0.755 4e-15
383852820 481 PREDICTED: Usher syndrome type-1G protei 0.653 0.101 0.734 6e-15
350412488 489 PREDICTED: Usher syndrome type-1G protei 0.653 0.100 0.755 6e-15
340725111 489 PREDICTED: Usher syndrome type-1G protei 0.653 0.100 0.755 6e-15
383852818 490 PREDICTED: Usher syndrome type-1G protei 0.653 0.1 0.734 7e-15
432868183 472 PREDICTED: Usher syndrome type-1G protei 0.653 0.103 0.755 8e-15
357609043 480 hypothetical protein KGM_13175 [Danaus p 0.653 0.102 0.714 8e-15
47217645 478 unnamed protein product [Tetraodon nigro 0.653 0.102 0.755 1e-14
>gi|328706555|ref|XP_003243130.1| PREDICTED: Usher syndrome type-1G protein homolog [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 91.7 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 39/49 (79%), Positives = 48/49 (97%)

Query: 27 RAAQDGMLDILREATKRDCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG 75
          +AAQDG +++L+EATKRDCNAKD+DGMTPTLWAAF+G+LEALR+LVGRG
Sbjct: 7  KAAQDGFVNLLKEATKRDCNAKDDDGMTPTLWAAFKGHLEALRVLVGRG 55




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321477337|gb|EFX88296.1| hypothetical protein DAPPUDRAFT_305682 [Daphnia pulex] Back     alignment and taxonomy information
>gi|270011619|gb|EFA08067.1| hypothetical protein TcasGA2_TC005663 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383852820|ref|XP_003701923.1| PREDICTED: Usher syndrome type-1G protein homolog isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|350412488|ref|XP_003489664.1| PREDICTED: Usher syndrome type-1G protein homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|340725111|ref|XP_003400917.1| PREDICTED: Usher syndrome type-1G protein homolog isoform 1 [Bombus terrestris] gi|340725113|ref|XP_003400918.1| PREDICTED: Usher syndrome type-1G protein homolog isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|383852818|ref|XP_003701922.1| PREDICTED: Usher syndrome type-1G protein homolog isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|432868183|ref|XP_004071452.1| PREDICTED: Usher syndrome type-1G protein homolog [Oryzias latipes] Back     alignment and taxonomy information
>gi|357609043|gb|EHJ66264.1| hypothetical protein KGM_13175 [Danaus plexippus] Back     alignment and taxonomy information
>gi|47217645|emb|CAG03042.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query75
UNIPROTKB|E1C0X4 469 USH1G "Uncharacterized protein 0.653 0.104 0.734 4.6e-15
UNIPROTKB|F1PVU5 456 USH1G "Uncharacterized protein 0.653 0.107 0.693 3.2e-14
UNIPROTKB|Q495M9 461 USH1G "Usher syndrome type-1G 0.653 0.106 0.693 3.3e-14
UNIPROTKB|F1RVV1 461 USH1G "Uncharacterized protein 0.653 0.106 0.693 3.3e-14
MGI|MGI:2450757 461 Ush1g "Usher syndrome 1G" [Mus 0.653 0.106 0.693 3.3e-14
RGD|1304551 461 Ush1g "Usher syndrome 1G" [Rat 0.653 0.106 0.693 3.3e-14
UNIPROTKB|E1BFU2 462 USH1G "Uncharacterized protein 0.653 0.106 0.693 3.3e-14
FB|FBgn0033785 516 Sans "Sans ortholog" [Drosophi 0.653 0.094 0.653 5.1e-13
ZFIN|ZDB-GENE-040704-29 422 anks4b "ankyrin repeat and ste 0.653 0.116 0.632 1.9e-12
UNIPROTKB|Q1JQD8 412 ANKS4B "Uncharacterized protei 0.653 0.118 0.632 2.3e-11
UNIPROTKB|E1C0X4 USH1G "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 198 (74.8 bits), Expect = 4.6e-15, P = 4.6e-15
 Identities = 36/49 (73%), Positives = 44/49 (89%)

Query:    27 RAAQDGMLDILREATKRDCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG 75
             RAA+DG LD+L+EATK+D N+ DEDGMTPTLWAA+ GNL+ALRL+V RG
Sbjct:     7 RAARDGYLDLLKEATKKDLNSPDEDGMTPTLWAAYHGNLDALRLIVSRG 55




GO:0005737 "cytoplasm" evidence=IEA
GO:0007605 "sensory perception of sound" evidence=IEA
GO:0015629 "actin cytoskeleton" evidence=IEA
GO:0042472 "inner ear morphogenesis" evidence=IEA
GO:0042803 "protein homodimerization activity" evidence=IEA
GO:0045494 "photoreceptor cell maintenance" evidence=IEA
GO:0050957 "equilibrioception" evidence=IEA
GO:0060113 "inner ear receptor cell differentiation" evidence=IEA
UNIPROTKB|F1PVU5 USH1G "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q495M9 USH1G "Usher syndrome type-1G protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RVV1 USH1G "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2450757 Ush1g "Usher syndrome 1G" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1304551 Ush1g "Usher syndrome 1G" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BFU2 USH1G "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0033785 Sans "Sans ortholog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040704-29 anks4b "ankyrin repeat and sterile alpha motif domain containing 4B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q1JQD8 ANKS4B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q80T11USH1G_MOUSENo assigned EC number0.69380.65330.1062yesN/A
Q495M9USH1G_HUMANNo assigned EC number0.69380.65330.1062yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-05
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-04
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 0.002
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 0.002
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.002
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 39.3 bits (92), Expect = 2e-05
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 28 AAQDGMLDILREATKRDC--NAKDEDGMTPTLWAAFQGNLEALRLLVGRG 75
          AA +G L++++   +     NAKD DG TP   AA  G+LE ++LL+ +G
Sbjct: 14 AASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKG 63


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-04
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-04
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-04
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-04
2xen_A91 Structural Determinants For Improved Thermal Stabil 3e-04
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 6e-04
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 6e-04
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 7e-04
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 8e-04
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure

Iteration: 1

Score = 40.4 bits (93), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 2/50 (4%) Query: 28 AAQDGMLDILREATKR--DCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG 75 AA++G +I++ + D NAKD DG TP +AA +G+ E ++LL+ +G Sbjct: 44 AAKEGHKEIVKLLISKGADVNAKDSDGRTPLHYAAKEGHKEIVKLLISKG 93
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-06
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 5e-07
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 7e-06
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 1e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-05
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 2e-04
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-04
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 8e-07
1bi7_B 156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-04
3f6q_A 179 Integrin-linked protein kinase; ILK, integrin-link 9e-07
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-05
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-04
3f6q_A 179 Integrin-linked protein kinase; ILK, integrin-link 7e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-06
1d9s_A 136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-04
3v31_A 167 Ankyrin repeat family A protein 2; structural geno 1e-06
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-06
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-05
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-05
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-06
3v30_A 172 DNA-binding protein rfxank; structural genomics co 2e-06
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-06
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-06
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-05
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-06
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-06
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-05
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-05
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 4e-05
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 5e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-04
3hra_A 201 Ankyrin repeat family protein; structural protein; 2e-06
3hra_A 201 Ankyrin repeat family protein; structural protein; 3e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-06
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-04
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-06
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-06
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 9e-06
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 3e-06
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 5e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-05
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 1e-05
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 2e-05
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-05
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-06
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-05
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-05
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-04
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-06
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-06
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-06
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-06
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-05
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-05
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-05
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-05
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-05
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-05
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-04
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-04
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-06
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-04
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-04
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-04
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 7e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-04
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-06
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-05
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-05
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-04
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-04
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-06
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-04
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-04
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-06
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-05
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-05
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 1e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-05
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-05
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 3e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-05
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-04
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 8e-04
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 1e-05
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 2e-04
2etb_A256 Transient receptor potential cation channel subfam 1e-05
2rfm_A 192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-05
2rfm_A 192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-04
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-05
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-05
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-04
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-05
1ihb_A 162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-05
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-05
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-04
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-04
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-04
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-04
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-05
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-05
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-05
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-04
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-04
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-05
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-04
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-05
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-05
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-04
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-04
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-04
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-05
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-05
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-04
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-05
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-05
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-04
3c5r_A 137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-04
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-05
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 7e-05
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-04
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 1e-04
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 3e-04
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-05
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 2e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-05
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-05
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-05
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-04
2rfa_A 232 Transient receptor potential cation channel subfa 1e-04
2rfa_A 232 Transient receptor potential cation channel subfa 7e-04
2pnn_A273 Transient receptor potential cation channel subfa 1e-04
2pnn_A 273 Transient receptor potential cation channel subfa 2e-04
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
 Score = 42.3 bits (101), Expect = 4e-07
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 28 AAQDGMLDILREATKR--DCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG 75
          AA++G L++++   +   D NAKD++G TP   AA  G+LE ++LL+  G
Sbjct: 9  AARNGHLEVVKLLLEAGADVNAKDKNGRTPLHLAARNGHLEVVKLLLEAG 58


>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query75
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.89
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.87
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.86
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.84
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.84
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.83
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.83
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.83
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.83
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.83
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.82
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.82
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.82
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.81
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.81
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.81
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.81
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.81
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.81
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.81
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.81
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.81
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.81
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.8
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.8
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.8
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.8
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.8
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.8
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.79
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.79
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 99.79
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.79
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.79
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.79
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.78
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 99.78
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.78
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.78
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.78
3hra_A201 Ankyrin repeat family protein; structural protein; 99.77
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.77
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.77
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.77
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.77
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.76
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.76
2rfa_A232 Transient receptor potential cation channel subfa 99.76
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.76
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.76
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.76
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.76
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.76
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.76
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.76
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.76
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.76
2etb_A256 Transient receptor potential cation channel subfam 99.75
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.75
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.75
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.75
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.75
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.75
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.75
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.75
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.75
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.74
3hra_A201 Ankyrin repeat family protein; structural protein; 99.74
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.74
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.74
2pnn_A273 Transient receptor potential cation channel subfa 99.74
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.74
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 99.73
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.73
2rfa_A232 Transient receptor potential cation channel subfa 99.73
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.73
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.73
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.73
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.73
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.73
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 99.73
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.73
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.72
2pnn_A273 Transient receptor potential cation channel subfa 99.72
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.72
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.72
2etb_A256 Transient receptor potential cation channel subfam 99.72
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 99.72
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.72
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.72
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.71
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.71
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.71
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.71
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.7
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.7
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.7
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.69
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.68
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 99.67
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.67
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.67
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.67
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.66
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 99.65
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.64
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.64
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.63
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.63
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.52
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.42
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
Probab=99.89  E-value=3.1e-22  Score=91.83  Aligned_cols=74  Identities=31%  Similarity=0.399  Sum_probs=69.8

Q ss_pred             hHHHHHHHhCCCCCCCCCCCCChHHHHHhcCCHHHHHHHHh--cCCCCCCCCCchHHHHHHHhCCHHHHHHHHhCC
Q psy13529          2 AILVLLVTNRAYGPQANSSYLLLPPRAAQDGMLDILREATK--RDCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG   75 (75)
Q Consensus         2 ~~~~~ll~~~~~~~~~d~~~~~~l~~a~~~~~~~~~~~l~~--~~~~~~~~~~~t~l~~a~~~~~~~~~~~L~~~g   75 (75)
                      .++++|+..+++++.+|..|+||||+|+..++.+++++|+.  ++++.+|..|+||+|+|+..++.+++++|+++|
T Consensus        16 ~~v~~Ll~~g~~~n~~d~~g~t~L~~A~~~~~~~~v~~Ll~~ga~~~~~d~~g~t~l~~A~~~~~~~~~~~Ll~~g   91 (93)
T 1n0q_A           16 EVVKLLLEAGADVNAKDKNGRTPLHLAARNGHLEVVKLLLEAGADVNAKDKNGRTPLHLAARNGHLEVVKLLLEAG   91 (93)
T ss_dssp             HHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTT
T ss_pred             HHHHHHHHcCCCCcccCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCccCCCCCCHHHHHHHcCCHHHHHHHHHcC
Confidence            46788999999999999999999999999999999999997  788899999999999999999999999999886



>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 75
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-05
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-05
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-05
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.003
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.002
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.002
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-06
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-06
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-05
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 7e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 8e-06
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-05
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-05
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-05
d1uoha_ 223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-05
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.001
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-04
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-04
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 45.0 bits (105), Expect = 9e-08
 Identities = 13/50 (26%), Positives = 21/50 (42%), Gaps = 2/50 (4%)

Query: 28 AAQDGMLDILREATKR--DCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG 75
          A+  G L I++   +R    N  +    TP   AA  G+ E  + L+   
Sbjct: 7  ASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNK 56


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query75
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.87
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.86
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.82
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.82
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.81
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.79
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.78
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.77
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.74
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.74
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.73
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.72
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.71
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.71
d1k1aa_ 228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1oy3d_ 255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.68
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.67
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.66
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.65
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.65
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.63
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.63
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.62
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.62
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.61
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.61
d1iknd_ 221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.6
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.59
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.59
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.59
d1sw6a_ 301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.48
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.43
d1wdya_ 285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.27
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 53BP2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.89  E-value=5.1e-23  Score=98.53  Aligned_cols=74  Identities=23%  Similarity=0.262  Sum_probs=69.9

Q ss_pred             hHHHHHHHhCCCCCCCCCCCCChHHHHHhcCCHHHHHHHHh--cCCCCCCCCCchHHHHHHHhCCHHHHHHHHhCC
Q psy13529          2 AILVLLVTNRAYGPQANSSYLLLPPRAAQDGMLDILREATK--RDCNAKDEDGMTPTLWAAFQGNLEALRLLVGRG   75 (75)
Q Consensus         2 ~~~~~ll~~~~~~~~~d~~~~~~l~~a~~~~~~~~~~~l~~--~~~~~~~~~~~t~l~~a~~~~~~~~~~~L~~~g   75 (75)
                      .++++|+..+++++.+|..|+||||+|+..++.+++++++.  ++.+..|..|+||||+|+..|+.+++++|+++|
T Consensus        15 ~~v~~Ll~~g~d~n~~d~~g~t~Lh~A~~~~~~~~~~~ll~~g~~~~~~d~~g~tpLh~A~~~g~~~~v~~Ll~~g   90 (130)
T d1ycsb1          15 DLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESG   90 (130)
T ss_dssp             HHHHHHTSTTSSCCCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHHTT
T ss_pred             HHHHHHHHcCCCccccccccccccccccccccccccccccccccccccccccCcccccccchhhHHHHHHHHHHcC
Confidence            46889999999999999999999999999999999999997  788999999999999999999999999999876



>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure