Diaphorina citri psyllid: psy13537


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MEGLSLDQIQADTMKLIRHFVGPKVTIPEPTRCLHSSWGTNPHFRGSYREREREIEIFPSKQMPGQTPIDLSKKLLLKKEVTKIHWEDPKGVLVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLTAIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWTDEDQKNLFKEIGQVDGKPWVVGLTGFFASTEDPLTLLEVDA
cccccHHHHHHHHHHHHHHHccccccccccccCEECcccccccccccccccccEEEEEccccccccccccccccEEccccEEEEEccccccEEEEEccccEEEccEEEEEEcHHHHccccCEccccccHHHHHHHHccccccEEEEEEEccccccccccccEEEECcccccccccEEccccccccEEEEccEEEEEcccccccEEccc
****SLDQIQADTMKLIRHFVGPKVTIPEPTRCLHSSWGTNPHFRGSYREREREIEIFPSKQMPGQTPIDLSKKLLLKKEVTKIHWEDPKGVLVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLTAIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWTDEDQKNLFKEIGQVDGKPWVVGLTGFFASTEDPLTLLE***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGLSLDQIQADTMKLIRHFVGPKVTIPEPTRCLHSSWGTNPHFRGSYREREREIEIFPSKQMPGQTPIDLSKKLLLKKEVTKIHWEDPKGVLVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLTAIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWTDEDQKNLFKEIGQVDGKPWVVGLTGFFASTEDPLTLLEVDA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044424 [CC]intracellular partprobableGO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0006598 [BP]polyamine catabolic processprobableGO:0009308, GO:1901575, GO:1901564, GO:1901565, GO:0006576, GO:0071704, GO:0009987, GO:0009310, GO:0044237, GO:0043170, GO:0044106, GO:0042402, GO:0006807, GO:0008150, GO:0008152, GO:0034641, GO:0006595, GO:0009056
GO:0046592 [MF]polyamine oxidase activityprobableGO:0003824, GO:0003674, GO:0016647, GO:0016645, GO:0016491
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XAG, chain A
Confidence level:very confident
Coverage over the Query: 47-168
View the alignment between query and template
View the model in PyMOL
Template: 1B37, chain A
Confidence level:very confident
Coverage over the Query: 2-51
View the alignment between query and template
View the model in PyMOL