Psyllid ID: psy13537

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MEGLSLDQIQADTMKLIRHFVGPKVTIPEPTRCLHSSWGTNPHFRGSYREREREIEIFPSKQMPGQTPIDLSKKLLLKKEVTKIHWEDPKGVLVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLTAIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWTDEDQKNLFKEIGQVDGKPWVVGLTGFFASTEDPLTLLEVDA
cccccHHHHHHHHHHHHHHHccccccccccccEEEEcccccccccccccccccEEEEEccccccccccccccccEEccccEEEEEccccccEEEEEccccEEEccEEEEEEcHHHHHcccEEccccccHHHHHHHHccccccEEEEEEEccccccccccccEEEEEcccccccccEEccccccccEEEEccEEEEEcccccccEEccc
cccEEEcHHHHHHHHHHHHHccHHHHccccccccccccccccEEEEcccccccEEEEEcccccccEccccccccEEEcEEEEEEEEccccEEEEEEccccEEEEcEEEEcccHHHHcccccEEEccccHHHHHHHHHcEEEcEEEEEEEccccccccccccEEEEcccccHccHHHHHHccccccEEEEEEEEEEEccccHHEEEEcc
MEGLSLDQIQADTMKLIRHfvgpkvtipeptrclhsswgtnphfrgsyrerereieifpskqmpgqtpidlSKKLLLKKEVTkihwedpkgvlvtcadgtqysadRILITVSLGVLksnlitfvpplppkkltaiegLYIGTIDKLFLkfpskwwpdsiqgynflwtdeDQKNLFKEigqvdgkpwvvgltgffastedpltllevda
MEGLSLDQIQADTMKLIRHFvgpkvtipeptrclhsswgtnphfrGSYREREREIEifpskqmpgqtpiDLSKKLLLKKEVTkihwedpkgvlvtCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLTAIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWTDEDQKNLFKEIGQVDGKPWVVGLTGffastedpltllevda
MEGLSLDQIQADTMKLIRHFVGPKVTIPEPTRCLHSSWGTNPHFRGSYREREREIEIFPSKQMPGQTPIDLSKKLLLKKEVTKIHWEDPKGVLVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLTAIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWTDEDQKNLFKEIGQVDGKPWVVGLTGFFASTEDPLTLLEVDA
**********ADTMKLIRHFVGPKVTIPEPTRCLHSSWGTNPHFR************************DLSKKLLLKKEVTKIHWEDPKGVLVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLTAIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWTDEDQKNLFKEIGQVDGKPWVVGLTGFFASTEDPLT******
****SLDQIQADTMKLIRHFVGPKVTIPEPTRCLHSSWGTNPHFRGSYREREREIEIFPSKQMPGQTPIDLSKKLLLKKEVTKIHWEDPKGVLVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLTAIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWTDEDQKNLFKEIGQVDGKPWVVGLTGFFASTEDPLTLLE***
MEGLSLDQIQADTMKLIRHFVGPKVTIPEPTRCLHSSWGTNPHFRGSYREREREIEIFPSKQMPGQTPIDLSKKLLLKKEVTKIHWEDPKGVLVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLTAIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWTDEDQKNLFKEIGQVDGKPWVVGLTGFFASTEDPLTLLEVDA
**GLSLDQIQADTMKLIRHFVGPKVTIPEPTRCLHSSWGTNPHFRGSYREREREIEIFPSKQMPGQTPIDLSKKLLLKKEVTKIHWEDPKGVLVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLTAIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWTDEDQKNLFKEIGQVDGKPWVVGLTGFFASTEDPLTLLEVDA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGLSLDQIQADTMKLIRHFVGPKVTIPEPTRCLHSSWGTNPHFRGSYREREREIEIFPSKQMPGQTPIDLSKKLLLKKEVTKIHWEDPKGVLVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLTAIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWTDEDQKNLFKEIGQVDGKPWVVGLTGFFASTEDPLTLLEVDA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query208 2.2.26 [Sep-21-2011]
O64411 500 Polyamine oxidase OS=Zea N/A N/A 0.447 0.186 0.425 7e-13
Q9NWM0 555 Spermine oxidase OS=Homo no N/A 0.663 0.248 0.328 2e-12
Q8NB78822 Lysine-specific histone d no N/A 0.355 0.090 0.459 2e-12
Q8CIG3826 Lysine-specific histone d yes N/A 0.466 0.117 0.37 8e-12
Q99K82 555 Spermine oxidase OS=Mus m no N/A 0.649 0.243 0.331 1e-11
Q8H191 497 Probable polyamine oxidas yes N/A 0.389 0.162 0.432 1e-11
Q6YYZ1 763 Lysine-specific histone d no N/A 0.615 0.167 0.347 3e-10
Q6QHF9 649 Peroxisomal N(1)-acetyl-s no N/A 0.451 0.144 0.342 3e-10
Q6Z690 849 Lysine-specific histone d no N/A 0.485 0.118 0.365 4e-10
Q865R1 512 Peroxisomal N(1)-acetyl-s no N/A 0.451 0.183 0.352 4e-10
>sp|O64411|PAO_MAIZE Polyamine oxidase OS=Zea mays GN=PAO PE=1 SV=1 Back     alignment and function desciption
 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 56/94 (59%), Gaps = 1/94 (1%)

Query: 74  KLLLKKEVTKIHWEDPKGVLVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLT 133
           +L L K V +I +  P GV V   D + YSAD ++++ SLGVL+S+LI F P LP  K+ 
Sbjct: 258 RLQLNKVVREIKYS-PGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVR 316

Query: 134 AIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWT 167
           AI    +    K+FLKFP K+WP+      FL+ 
Sbjct: 317 AIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYA 350
Catalyzes the oxidation of the secondary amino group of polyamines (spermine, spermidine and their acetyl derivatives). Plays an important role in the regulation of polyamine intracellular concentration.
Zea mays (taxid: 4577)
EC: 1EC: .EC: 5EC: .EC: 3EC: .EC: 1EC: 5
>sp|Q9NWM0|SMOX_HUMAN Spermine oxidase OS=Homo sapiens GN=SMOX PE=1 SV=1 Back     alignment and function description
>sp|Q8NB78|KDM1B_HUMAN Lysine-specific histone demethylase 1B OS=Homo sapiens GN=KDM1B PE=1 SV=3 Back     alignment and function description
>sp|Q8CIG3|KDM1B_MOUSE Lysine-specific histone demethylase 1B OS=Mus musculus GN=Kdm1b PE=1 SV=1 Back     alignment and function description
>sp|Q99K82|SMOX_MOUSE Spermine oxidase OS=Mus musculus GN=Smox PE=1 SV=1 Back     alignment and function description
>sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 Back     alignment and function description
>sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 Back     alignment and function description
>sp|Q6QHF9|PAOX_HUMAN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Homo sapiens GN=PAOX PE=1 SV=3 Back     alignment and function description
>sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 Back     alignment and function description
>sp|Q865R1|PAOX_BOVIN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Bos taurus GN=PAOX PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
270002494 931 hypothetical protein TcasGA2_TC004564 [T 0.769 0.171 0.363 4e-22
189234099 433 PREDICTED: similar to amine oxidase [Tri 0.769 0.369 0.363 4e-22
328723284 475 PREDICTED: peroxisomal N(1)-acetyl-sperm 0.639 0.28 0.427 3e-21
242021355 477 Peroxisomal N1-acetyl-spermine/spermidin 0.596 0.259 0.426 1e-20
322795354 838 hypothetical protein SINV_80022 [Solenop 0.615 0.152 0.389 1e-19
307183354 475 Peroxisomal N(1)-acetyl-spermine/spermid 0.668 0.292 0.391 1e-19
332019664 563 Peroxisomal N(1)-acetyl-spermine/spermid 0.605 0.223 0.403 1e-19
332019665 755 Peroxisomal N(1)-acetyl-spermine/spermid 0.644 0.177 0.363 3e-19
170054634 481 spermine oxidase [Culex quinquefasciatus 0.668 0.288 0.402 7e-19
157120558 479 amine oxidase [Aedes aegypti] gi|1088749 0.668 0.290 0.369 4e-18
>gi|270002494|gb|EEZ98941.1| hypothetical protein TcasGA2_TC004564 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 95/176 (53%), Gaps = 16/176 (9%)

Query: 45  RGSYREREREIEIFPSKQMPG-QTPIDLSKK------------LLLKKEVTKIHWEDPKG 91
            G+Y+ +E E +++   +  G +T +D+  K            +LL KEV KI W+    
Sbjct: 179 NGAYQYKECEGDLYLQWRKTGFKTVLDVLMKKIPDPSRTLPVEILLNKEVNKIIWDCDNN 238

Query: 92  VLVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLTAIEGLYIGTIDKLFLKFP 151
           V V C D + +  D ++IT S+G LK+   +F P LPP K +AI+   IG + K+ LKFP
Sbjct: 239 VTVRCTDNSAFKCDHLIITASIGALKNLSESFEPQLPPIKQSAIDLTAIGDVKKILLKFP 298

Query: 152 SKWWPDSIQGYNFLWTDEDQKNLFKEIGQ---VDGKPWVVGLTGFFASTEDPLTLL 204
            KWWPDS +G + +W D D++ L  E  Q    DGK W+  + GF+     P  LL
Sbjct: 299 KKWWPDSFKGLSLVWRDSDREKLSTEFPQGPIKDGKSWLEYIYGFYVIDSHPDVLL 354

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189234099|ref|XP_967311.2| PREDICTED: similar to amine oxidase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328723284|ref|XP_001948577.2| PREDICTED: peroxisomal N(1)-acetyl-spermine/spermidine oxidase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242021355|ref|XP_002431110.1| Peroxisomal N1-acetyl-spermine/spermidine oxidase precursor, putative [Pediculus humanus corporis] gi|212516359|gb|EEB18372.1| Peroxisomal N1-acetyl-spermine/spermidine oxidase precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|322795354|gb|EFZ18159.1| hypothetical protein SINV_80022 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307183354|gb|EFN70212.1| Peroxisomal N(1)-acetyl-spermine/spermidine oxidase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332019664|gb|EGI60138.1| Peroxisomal N(1)-acetyl-spermine/spermidine oxidase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|332019665|gb|EGI60139.1| Peroxisomal N(1)-acetyl-spermine/spermidine oxidase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|170054634|ref|XP_001863219.1| spermine oxidase [Culex quinquefasciatus] gi|167874906|gb|EDS38289.1| spermine oxidase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157120558|ref|XP_001653663.1| amine oxidase [Aedes aegypti] gi|108874903|gb|EAT39128.1| AAEL009044-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
FB|FBgn0033584 509 CG7737 [Drosophila melanogaste 0.615 0.251 0.370 3.9e-18
FB|FBgn0035943 480 CG5653 [Drosophila melanogaste 0.764 0.331 0.356 1.9e-17
ZFIN|ZDB-GENE-030131-5768 495 zgc:66484 "zgc:66484" [Danio r 0.682 0.286 0.335 1.2e-16
FB|FBgn0036750 479 CG6034 [Drosophila melanogaste 0.548 0.237 0.405 1.4e-16
FB|FBgn0036749 486 CG7460 [Drosophila melanogaste 0.615 0.263 0.358 5.3e-16
UNIPROTKB|E2R8S7 555 SMOX "Uncharacterized protein" 0.375 0.140 0.455 1.5e-13
ZFIN|ZDB-GENE-031201-3 539 smox "spermine oxidase" [Danio 0.399 0.153 0.428 1.7e-13
UNIPROTKB|Q5TE25 442 SMOX "Spermine oxidase" [Homo 0.663 0.312 0.335 1.7e-13
UNIPROTKB|Q9NWM0 555 SMOX "Spermine oxidase" [Homo 0.663 0.248 0.335 2.7e-13
UNIPROTKB|D4A3P5 545 RGD1564480 "Protein RGD1564480 0.649 0.247 0.335 3.4e-13
FB|FBgn0033584 CG7737 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 227 (85.0 bits), Expect = 3.9e-18, P = 3.9e-18
 Identities = 50/135 (37%), Positives = 78/135 (57%)

Query:    71 LSKKLLLKKEVTKIHWEDPKG-VLVTCADGTQYSADRILITVSLGVLKS-NLITFVPPLP 128
             L ++LLL   V KI+W    G V +  ++G    AD +++TVSLGVLK  +L  F P LP
Sbjct:   228 LEQRLLLGTRVVKINWNRNDGRVELQMSNGETCIADHVVVTVSLGVLKDQHLRLFEPQLP 287

Query:   129 PKKLTAIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWTDEDQKNLFKEIGQVDGKPWVV 188
              +K  AI+GL  GT++K+F++FP  +WP+   G+  LW DED  ++     +   + W+ 
Sbjct:   288 VEKQRAIDGLAFGTVNKIFVEFPEAFWPEDWTGFTMLWRDEDLDDI-----RGTSRAWLE 342

Query:   189 GLTGFFASTEDPLTL 203
              + GF+  +  P  L
Sbjct:   343 DVFGFYRVSYQPRIL 357
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
FB|FBgn0035943 CG5653 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5768 zgc:66484 "zgc:66484" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0036750 CG6034 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0036749 CG7460 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8S7 SMOX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031201-3 smox "spermine oxidase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TE25 SMOX "Spermine oxidase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NWM0 SMOX "Spermine oxidase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D4A3P5 RGD1564480 "Protein RGD1564480" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
pfam01593444 pfam01593, Amino_oxidase, Flavin containing amine 1e-20
PLN02676 487 PLN02676, PLN02676, polyamine oxidase 6e-20
PLN02268435 PLN02268, PLN02268, probable polyamine oxidase 6e-18
PLN02568 539 PLN02568, PLN02568, polyamine oxidase 2e-14
PLN02976 1713 PLN02976, PLN02976, amine oxidase 2e-13
PLN02328 808 PLN02328, PLN02328, lysine-specific histone demeth 7e-12
PLN03000 881 PLN03000, PLN03000, amine oxidase 4e-11
PLN02529 738 PLN02529, PLN02529, lysine-specific histone demeth 6e-11
COG1231450 COG1231, COG1231, Monoamine oxidase [Amino acid tr 7e-10
pfam01593444 pfam01593, Amino_oxidase, Flavin containing amine 1e-04
PLN02676487 PLN02676, PLN02676, polyamine oxidase 0.001
>gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase Back     alignment and domain information 
 Score = 88.4 bits (219), Expect = 1e-20
 Identities = 39/103 (37%), Positives = 55/103 (53%), Gaps = 3/103 (2%)

Query: 70  DLSKKLLLKKEVTKIHWEDPKGVLVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPP 129
            L  ++ L   V  I      GV VT  DG    AD +++TV LGVLK   I F+PPLP 
Sbjct: 216 LLGGRVRLNTRVRSITKS-GDGVTVTTVDGRTIEADAVIVTVPLGVLKR--ILFLPPLPA 272

Query: 130 KKLTAIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWTDEDQK 172
            K  AI  L  G++ K+FL+F + +WP++   +  L TD   +
Sbjct: 273 AKQEAIRNLGFGSVSKVFLEFETPFWPENGDLFGLLVTDGLSR 315

This family consists of various amine oxidases, including maze polyamine oxidase (PAO) and various flavin containing monoamine oxidases (MAO). The aligned region includes the flavin binding site of these enzymes. The family also contains phytoene dehydrogenases and related enzymes. In vertebrates MAO plays an important role regulating the intracellular levels of amines via there oxidation; these include various neurotransmitters, neurotoxins and trace amines. In lower eukaryotes such as aspergillus and in bacteria the main role of amine oxidases is to provide a source of ammonium. PAOs in plants, bacteria and protozoa oxidase spermidine and spermine to an aminobutyral, diaminopropane and hydrogen peroxide and are involved in the catabolism of polyamines. Other members of this family include tryptophan 2-monooxygenase, putrescine oxidase, corticosteroid binding proteins and antibacterial glycoproteins. Length = 444
>gnl|CDD|215362 PLN02676, PLN02676, polyamine oxidase Back     alignment and domain information
>gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase Back     alignment and domain information
>gnl|CDD|215308 PLN02568, PLN02568, polyamine oxidase Back     alignment and domain information
>gnl|CDD|215527 PLN02976, PLN02976, amine oxidase Back     alignment and domain information
>gnl|CDD|215187 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>gnl|CDD|178578 PLN03000, PLN03000, amine oxidase Back     alignment and domain information
>gnl|CDD|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1 Back     alignment and domain information
>gnl|CDD|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase Back     alignment and domain information
>gnl|CDD|215362 PLN02676, PLN02676, polyamine oxidase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
1b37_A 472 A 30 Angstrom U-Shaped Catalytic Tunnel In The Crys 6e-14
4fwe_A796 Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup 2e-13
4gu1_A784 Crystal Structure Of Lsd2 Length = 784 2e-13
4gur_A776 Crystal Structure Of Lsd2-npac With H3 In Space Gro 2e-13
3kpf_A 478 X-Ray Structure Of The Mutant Lys300met Of Polyamin 3e-13
1z6l_A 516 Crystal Structure Of Fms1 In Complex With Its Subst 8e-08
4ech_A 516 Yeast Polyamine Oxidase Fms1, H67q Mutant Length = 8e-08
4gdp_A 516 Yeast Polyamine Oxidase Fms1, N195a Mutant Length = 8e-08
1yy5_A 513 Crystal Structure Of Fms1, A Polyamine Oxidase From 9e-08
1rsg_A 516 Crystal Structure Of The Polyamine Oxidase Fms1 Fro 9e-08
2hko_A 664 Crystal Structure Of Lsd1 Length = 664 1e-05
2v1d_A 730 Structural Basis Of Lsd1-Corest Selectivity In Hist 1e-05
2h94_A 664 Crystal Structure And Mechanism Of Human Lysine-Spe 1e-05
2iw5_A 666 Structural Basis For Corest-dependent Demethylation 1e-05
2dw4_A 660 Crystal Structure Of Human Lsd1 At 2.3 A Resolution 1e-05
2ejr_A 662 Lsd1-Tranylcypromine Complex Length = 662 1e-05
2xaf_A 852 Crystal Structure Of Lsd1-Corest In Complex With Pa 1e-05
2x0l_A 734 Crystal Structure Of A Neuro-Specific Splicing Vari 1e-05
3kve_A486 Structure Of Native L-Amino Acid Oxidase From Viper 5e-05
1f8r_A 498 Crystal Structure Of L-Amino Acid Oxidase From Call 6e-05
4e0v_A497 Structure Of L-Amino Acid Oxidase From The B. Jarar 3e-04
1reo_A486 L-Amino Acid Oxidase From Agkistrodon Halys Pallas 5e-04
>pdb|1B37|A Chain A, A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal Structure Of Polyamine Oxidase Length = 472 Back     alignment and structure 
Iteration: 1

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 56/94 (59%), Gaps = 1/94 (1%)
Query: 74  KLLLKKEVTKIHWEDPKGVLVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLT 133
           +L L K V +I +  P GV V   D + YSAD ++++ SLGVL+S+LI F P LP  K+ 
Sbjct: 230 RLQLNKVVREIKYS-PGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVR 288
Query: 134 AIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWT 167
           AI    +    K+FLKFP K+WP+      FL+ 
Sbjct: 289 AIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYA 322
>pdb|4FWE|A Chain A, Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup Of C2221 At 2.13a Length = 796 Back     alignment and structure
>pdb|4GU1|A Chain A, Crystal Structure Of Lsd2 Length = 784 Back     alignment and structure
>pdb|4GUR|A Chain A, Crystal Structure Of Lsd2-npac With H3 In Space Group P21 Length = 776 Back     alignment and structure
>pdb|3KPF|A Chain A, X-Ray Structure Of The Mutant Lys300met Of Polyamine Oxidase From Zea Mays Length = 478 Back     alignment and structure
>pdb|1Z6L|A Chain A, Crystal Structure Of Fms1 In Complex With Its Substrate Length = 516 Back     alignment and structure
>pdb|4ECH|A Chain A, Yeast Polyamine Oxidase Fms1, H67q Mutant Length = 516 Back     alignment and structure
>pdb|4GDP|A Chain A, Yeast Polyamine Oxidase Fms1, N195a Mutant Length = 516 Back     alignment and structure
>pdb|1YY5|A Chain A, Crystal Structure Of Fms1, A Polyamine Oxidase From Yeast Length = 513 Back     alignment and structure
>pdb|1RSG|A Chain A, Crystal Structure Of The Polyamine Oxidase Fms1 From Yeast Length = 516 Back     alignment and structure
>pdb|2HKO|A Chain A, Crystal Structure Of Lsd1 Length = 664 Back     alignment and structure
>pdb|2V1D|A Chain A, Structural Basis Of Lsd1-Corest Selectivity In Histone H3 Recognition Length = 730 Back     alignment and structure
>pdb|2H94|A Chain A, Crystal Structure And Mechanism Of Human Lysine-Specific Demethylase-1 Length = 664 Back     alignment and structure
>pdb|2IW5|A Chain A, Structural Basis For Corest-dependent Demethylation Of Nucleosomes By The Human Lsd1 Histone Demethylase Length = 666 Back     alignment and structure
>pdb|2DW4|A Chain A, Crystal Structure Of Human Lsd1 At 2.3 A Resolution Length = 660 Back     alignment and structure
>pdb|2EJR|A Chain A, Lsd1-Tranylcypromine Complex Length = 662 Back     alignment and structure
>pdb|2XAF|A Chain A, Crystal Structure Of Lsd1-Corest In Complex With Para-Bromo- (+)-Cis-2-Phenylcyclopropyl-1-Amine Length = 852 Back     alignment and structure
>pdb|2X0L|A Chain A, Crystal Structure Of A Neuro-Specific Splicing Variant Of Human Histone Lysine Demethylase Lsd1 Length = 734 Back     alignment and structure
>pdb|3KVE|A Chain A, Structure Of Native L-Amino Acid Oxidase From Vipera Ammodytes Ammodytes: Stabilization Of The Quaternary Structure By Divalent Ions And Structural Changes In The Dynamic Active Site Length = 486 Back     alignment and structure
>pdb|1F8R|A Chain A, Crystal Structure Of L-Amino Acid Oxidase From Calloselasma Rhodostoma Complexed With Citrate Length = 498 Back     alignment and structure
>pdb|4E0V|A Chain A, Structure Of L-Amino Acid Oxidase From The B. Jararacussu Venom Length = 497 Back     alignment and structure
>pdb|1REO|A Chain A, L-Amino Acid Oxidase From Agkistrodon Halys Pallas Length = 486 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 5e-37
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 5e-08
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 3e-29
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 3e-07
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 1e-28
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 7e-07
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 2e-27
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 4e-06
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 8e-26
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 1e-07
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 2e-25
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 2e-25
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 1e-04
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 5e-25
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 8e-07
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 2e-21
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 3e-17
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 4e-04
2e1m_B130 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 3e-14
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
 Score =  133 bits (335), Expect = 5e-37
 Identities = 43/136 (31%), Positives = 68/136 (50%), Gaps = 5/136 (3%)

Query: 62  QMPGQTPIDLSKKLLLKKEVTKIHWEDPKGVLVTCADGTQYSADRILITVSLGVLKSNLI 121
           +   ++   +  +L L K V +I +  P GV V   D + YSAD ++++ SLGVL+S+LI
Sbjct: 218 KTDDKSGKIVDPRLQLNKVVREIKY-SPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLI 276

Query: 122 TFVPPLPPKKLTAIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWTDEDQK--NLFKEIG 179
            F P LP  K+ AI    +    K+FLKFP K+WP+      FL+    +    +++E  
Sbjct: 277 QFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFE 336

Query: 180 QVDGKPWVVGLTGFFA 195
           +      V  L     
Sbjct: 337 KQYPDANV--LLVTVT 350
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 130 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 99.72
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 99.69
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 99.67
2e1m_B130 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 99.53
4gut_A776 Lysine-specific histone demethylase 1B; histone de 99.52
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 99.51
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 99.45
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 99.38
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 99.38
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.3
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.29
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 99.28
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 99.27
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.27
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.23
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 99.16
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 99.09
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 99.08
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 99.02
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 98.62
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.5
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.45
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 98.34
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.32
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 98.07
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.93
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 95.94
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 95.41
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 95.36
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 95.18
4gut_A776 Lysine-specific histone demethylase 1B; histone de 95.03
4hb9_A 412 Similarities with probable monooxygenase; flavin, 95.0
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 94.64
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 94.19
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 93.73
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 93.67
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 93.59
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 93.58
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 93.54
3dme_A369 Conserved exported protein; structural genomics, P 93.45
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 93.23
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 93.06
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 92.97
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 92.9
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 92.65
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 92.61
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 92.09
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 92.03
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 91.65
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 91.6
2ywl_A180 Thioredoxin reductase related protein; uncharacter 91.42
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 91.15
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 91.0
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 90.91
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 90.84
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 90.68
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 90.64
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 90.55
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 90.4
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 90.31
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 90.27
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 90.26
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 90.2
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 90.04
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 89.89
3ab1_A 360 Ferredoxin--NADP reductase; oxidoreductase, electr 89.68
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 89.66
2zbw_A 335 Thioredoxin reductase; redox protein, oxidoreducta 89.56
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 89.41
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 89.07
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 89.05
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 88.73
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 88.65
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 88.45
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 88.25
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 87.74
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 87.63
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 87.54
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 87.51
1fec_A 490 Trypanothione reductase; redox-active center, oxid 87.17
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 87.1
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 87.08
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 87.04
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 86.99
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 86.77
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 86.45
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 86.06
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 85.7
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 85.68
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 84.91
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 84.77
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 84.72
3f8d_A 323 Thioredoxin reductase (TRXB-3); redox protein, nuc 84.59
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 84.39
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 84.37
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 84.32
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 84.3
1fl2_A 310 Alkyl hydroperoxide reductase subunit F; reactive 83.99
4dna_A 463 Probable glutathione reductase; structural genomic 83.93
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 83.54
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 83.44
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 83.41
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 83.34
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 82.99
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 82.99
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 82.96
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 82.94
2cul_A232 Glucose-inhibited division protein A-related PROT 82.79
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 82.76
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 82.51
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 82.26
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 82.08
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 82.07
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 81.94
2q0l_A 311 TRXR, thioredoxin reductase; bacterial thiredoxin 81.69
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 81.57
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 81.13
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 81.05
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 81.01
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 80.57
3atr_A 453 Conserved archaeal protein; saturating double bond 80.45
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 80.05
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
Probab=99.72  E-value=5.8e-18  Score=157.49  Aligned_cols=113  Identities=26%  Similarity=0.453  Sum_probs=96.0

Q ss_pred             CcccccceeeeecCCCCCCCCCCCCCCcEEeCCceEEEEecCCCcEEEEEcC------CcEEEcCEEEEecChHHHHh--
Q psy13537         47 SYREREREIEIFPSKQMPGQTPIDLSKKLLLKKEVTKIHWEDPKGVLVTCAD------GTQYSADRILITVSLGVLKS--  118 (208)
Q Consensus        47 sys~~~G~~~~~~~a~~~~~l~~~l~~~I~l~~~V~~I~~~~~~~v~V~~~~------g~~~~ad~VI~TvP~~vl~~--  118 (208)
                      .+++.+|+.. ++.+++ +      +.+|++|++|++|++. +++|+|++.+      |.+++||+||||+|+++|++  
T Consensus       393 ~~~~~gG~~~-l~~~La-~------~l~I~l~~~V~~I~~~-~~~v~V~~~~~~~~~~~~~~~Ad~VI~tvP~~vL~~l~  463 (662)
T 2z3y_A          393 HLTVRNGYSC-VPVALA-E------GLDIKLNTAVRQVRYT-ASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQP  463 (662)
T ss_dssp             CEEETTCTTH-HHHHHT-T------TCEEETTEEEEEEEEE-TTEEEEEEEESSCTTCEEEEEESEEEECCCHHHHHCSS
T ss_pred             eeeecCcHHH-HHHHHH-h------cCceecCCeEEEEEEC-CCcEEEEEeecccCCCCeEEEeCEEEECCCHHHHhccc
Confidence            4666777776 445553 2      2269999999999994 7889999876      57899999999999999997  


Q ss_pred             ccccCCCCCcHHHHHHHhcCCCCceeeEEEEcCCCCCcCCCCeeEEeecC
Q psy13537        119 NLITFVPPLPPKKLTAIEGLYIGTIDKLFLKFPSKWWPDSIQGYNFLWTD  168 (208)
Q Consensus       119 ~~~~f~P~Lp~~~~~ai~~l~~~~~~Kv~l~f~~~fW~~~~~gfg~l~~~  168 (208)
                      ..+.|.|+||+.+.++|++++|++++||+|.|+++||+.+.++||+++..
T Consensus       464 ~~i~f~P~LP~~k~~Ai~~l~~g~~~KV~l~f~~~fW~~~~~~~G~l~~~  513 (662)
T 2z3y_A          464 PAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGST  513 (662)
T ss_dssp             CSSEEESCCCHHHHHHHHHSEECCCEEEEEECSSCCSCTTCSEEEECCSS
T ss_pred             CceEEcCCCCHHHHHHHHhCCccceeEEEEEcCcccccCCCCceeeecCC
Confidence            23579999999999999999999999999999999999888899988653
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 208
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 7e-12
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 5e-10
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 7e-09
d2v5za2112 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (H 2e-06
d1b5qa2112 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea 3e-06
d1b5qa2112 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea 4e-05
d2dw4a3109 d.16.1.5 (A:655-763) Lysine-specific histone demet 6e-06
d2dw4a3109 d.16.1.5 (A:655-763) Lysine-specific histone demet 2e-04
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 0.003
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Polyamine oxidase
species: Maize (Zea mays) [TaxId: 4577]

 Score = 61.1 bits (146), Expect = 7e-12
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 2/75 (2%)

Query: 83  KIHWEDPKGVLVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLTAIEGLYIGT 142
           +     P GV V   D + YSAD ++++ SLGVL+S+LI F P LP  K+ AI   +   
Sbjct: 234 REIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFWPVG 293

Query: 143 IDKLFLKFPSKWWPD 157
           +++   ++     P 
Sbjct: 294 VNR--YEYDQLRAPV 306
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 112 Back     information, alignment and structure
>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 112 Back     information, alignment and structure
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.81
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.78
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.66
d2dw4a3109 Lysine-specific histone demethylase 1, LSD1 {Human 98.27
d1b5qa2112 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.12
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.04
d2v5za2112 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.02
d1b5qa2112 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.85
d2v5za2112 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.54
d2dw4a3109 Lysine-specific histone demethylase 1, LSD1 {Human 97.5
d2iida2113 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.11
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 97.06
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.88
d2iida2113 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.73
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.43
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.35
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 96.29
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 96.25
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 96.1
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.89
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.8
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 95.49
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.48
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 95.0
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 94.81
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.8
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 94.73
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.16
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.4
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.01
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 92.95
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 92.77
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 91.44
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 91.21
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 90.54
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 90.41
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 89.73
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 89.06
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 83.77
d1seza2112 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 82.37
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 81.99
d2ivda2108 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 81.44
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Monoamine oxidase B
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.81  E-value=3.1e-09  Score=86.54  Aligned_cols=69  Identities=22%  Similarity=0.314  Sum_probs=62.9

Q ss_pred             CCcEEeCCceEEEEecCCCcEEEEEcCCcEEEcCEEEEecChHHHHhccccCCCCCcHHHHHHHhcCCCCce
Q psy13537         72 SKKLLLKKEVTKIHWEDPKGVLVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLTAIEGLYIGTI  143 (208)
Q Consensus        72 ~~~I~l~~~V~~I~~~~~~~v~V~~~~g~~~~ad~VI~TvP~~vl~~~~~~f~P~Lp~~~~~ai~~l~~~~~  143 (208)
                      +.+|++|++|++|.+ .+++|+|++.||++++||+||+|+|+.+++++  .|.|+||..+.+++.++.+...
T Consensus       221 g~~i~~~~~v~~I~~-~~~~v~v~~~~g~~~~ad~vI~a~p~~~~~~~--~~~p~l~~~~~~~~~~~~~~~~  289 (383)
T d2v5za1         221 GDRVKLERPVIYIDQ-TRENVLVETLNHEMYEAKYVISAIPPTLGMKI--HFNPPLPMMRNQMITRVFPPGI  289 (383)
T ss_dssp             GGGEEESCCEEEEEC-SSSSEEEEETTSCEEEESEEEECSCGGGGGGS--EEESCCCHHHHHHTTSCCCTTH
T ss_pred             CCeEEecCcceEEEe-cCCeEEEEECCCCEEECCEEEECCCHHHHhhC--ccCCCCCHHHHHHHHHhccCCc
Confidence            678999999999999 58899999999999999999999999999976  7999999999999998875543
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure