Diaphorina citri psyllid: psy13556


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------
CIDERGGGVFRSGELVPRFGPCEECRCTDGTVVCSMMQCEIKPGCQTIQRPNQCCPEFKCECEHNGKVYNNGEKLNSTLTPCQVCYCRGGALMCTHFTCFTRDDCQGRTLPGTCCPNYDHCPPLAHD
cCCccccEECccccCCccccccccEEEccccEEEEcccccccccccccccccccccccccccEEccEEEccccEECccccccccEEEcccEEEEEcccccccccccccccccccccccccccccccc
CIDERGGGVFRSGELVPRFGPCEECRCTDGTVVCSMMQCEIKPGCQTIQRPNQCCPEFKCECEHNGKVYNNGEKLNSTLTPCQVCYCRGGALMCTHFTCFTRDDCQGRTLPGTCCPNYDHCP*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CIDERGGGVFRSGELVPRFGPCEECRCTDGTVVCSMMQCEIKPGCQTIQRPNQCCPEFKCECEHNGKVYNNGEKLNSTLTPCQVCYCRGGALMCTHFTCFTRDDCQGRTLPGTCCPNYDHCPPLAHD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050840 [MF]extracellular matrix bindingprobableGO:0003674, GO:0005488
GO:0044420 [CC]extracellular matrix partprobableGO:0005575, GO:0031012
GO:0009967 [BP]positive regulation of signal transductionprobableGO:0009966, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0060284 [BP]regulation of cell developmentprobableGO:0050793, GO:0050794, GO:0045595, GO:0008150, GO:0065007, GO:0050789
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0010811 [BP]positive regulation of cell-substrate adhesionprobableGO:0045785, GO:0010810, GO:0030155, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0009968 [BP]negative regulation of signal transductionprobableGO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0032268 [BP]regulation of cellular protein metabolic processprobableGO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0031323, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0019838 [MF]growth factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0030334 [BP]regulation of cell migrationprobableGO:0051270, GO:0050794, GO:0008150, GO:0040012, GO:2000145, GO:0065007, GO:0032879, GO:0050789
GO:0030510 [BP]regulation of BMP signaling pathwayprobableGO:0090092, GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0005578 [CC]proteinaceous extracellular matrixprobableGO:0005575, GO:0005576, GO:0044421, GO:0031012
GO:0045597 [BP]positive regulation of cell differentiationprobableGO:0051094, GO:0050793, GO:0050794, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0008201 [MF]heparin bindingprobableGO:0043168, GO:1901681, GO:0097367, GO:0043167, GO:0005539, GO:0003674, GO:0005488
GO:0051260 [BP]protein homooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U5M, chain A
Confidence level:confident
Coverage over the Query: 61-121
View the alignment between query and template
View the model in PyMOL
Template: 1U5M, chain A
Confidence level:confident
Coverage over the Query: 3-59
View the alignment between query and template
View the model in PyMOL