Diaphorina citri psyllid: psy13560


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------63
MSVRTYGDKPISFQIEENGDFYCIGSEVGNYLRMFRGSLYKKYPGLFRRTISNEERKRLLDTAGINSHCLASSVTLLKVSEVEDILEGNDEKYKAVSIHTEPLVPRESKTKKAVPWAPSLPNSSHLDAVPQATPVNRNRVNQKKVRTFPLCFDDTDPSCIFENASHTEVLVPIRLDMEIEGQKLRDTFTWNKNGTVFSFCSLETLITPEQFAEVLCDDLDLNPLLFVPAIAQSIRQQTDAFPAENLLDEVHDQRVVIKLNIHVGNTSLVDQIEWDMSEKENSAEKFAVRLCTELGLGGEFVTAIAYSIRGQLSWHQRTYAFSEAPLPVVEAPFRSHSESDQWSPFLETLTDAEMEKKIRDQDRNTRESKTKKAVPWAPSLPNSSHLDAVPQATPVNRNRVNQKKVRTFPLCFDDTDPSCIFENASHTEVLVPIRLDMEIEGQKLRDTFTWNKNETLITPEQFAEVLCDDLDLNPLLFVPAIAQSIRQQTDAFPAENLLDEVHDQRVVIKLNIHVGNTSLVDQIEWDMSEKENSAEKFAVRLCTELGLGGEFVTAIAYSIRGQLSWHQRTYAFSEAPLPVVEAPFRSHSESDQWSPFLETLTDAEMEKKIRDQDRNTRRMRRLANTTTGW
cccccccccccEEEEccccCEEEEHHHHHHHHHcccccHHHHccccccccccHHHHHHHHHHccccccccccccccccccHHHHHccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccEEEEEEEEEEcccccEEEEEEEcccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEEccEEEEEEEEEccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHcccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccEEEEEEEEEcccEEEEEEEEEccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEEccEEEEEEEEEccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccc
*******DKPISFQIEENGDFYCIGSEVGNYLRMFRGSLYKKYPGLFRRTISNEERKRLLDTAGINSHCLASSVTLLKVSEVEDILEGNDEKYKAVSI****************************DAVPQA**************TFPLCFDDTDPSCIFENASHTEVLVPIRLDMEIEGQKLRDTFTWNKNGTVFSFCSLETLITPEQFAEVLCDDLDLNPLLFVPAIAQSIRQQTDAFPAENLLDEVHDQRVVIKLNIHVGNTSLVDQIEWDMSEKENSAEKFAVRLCTELGLGGEFVTAIAYSIRGQLSWHQRTYAFSEAPLPVVEAPFRSHSESDQWSPFLETLTDAEMEKKI************************************************TFPLCFDDTDPSCIFENASHTEVLVPIRLDMEIEGQKLRDTFTWNKNETLITPEQFAEVLCDDLDLNPLLFVPAIAQSIRQQTDAFPAENLLDEVHDQRVVIKLNIHVGNTSLVDQIEWDMSEKENSAEKFAVRLCTELGLGGEFVTAIAYSIRGQLSWHQRTYAFSEAPLPVVEAPFRSHSESDQWSPFLETLTDAE*************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVRTYGDKPISFQIEENGDFYCIGSEVGNYLRMFRGSLYKKYPGLFRRTISNEERKRLLDTAGINSHCLASSVTLLKVSEVEDILEGNDEKYKAVSIHTEPLVPRESKTKKAVPWAPSLPNSSHLDAVPQATPVNRNRVNQKKVRTFPLCFDDTDPSCIFENASHTEVLVPIRLDMEIEGQKLRDTFTWNKNGTVFSFCSLETLITPEQFAEVLCDDLDLNPLLFVPAIAQSIRQQTDAFPAENLLDEVHDQRVVIKLNIHVGNTSLVDQIEWDMSEKENSAEKFAVRLCTELGLGGEFVTAIAYSIRGQLSWHQRTYAFSEAPLPVVEAPFRSHSESDQWSPFLETLTDAEMEKKIRDQDRNTRESKTKKAVPWAPSLPNSSHLDAVPQATPVNRNRVNQKKVRTFPLCFDDTDPSCIFENASHTEVLVPIRLDMEIEGQKLRDTFTWNKNETLITPEQFAEVLCDDLDLNPLLFVPAIAQSIRQQTDAFPAENLLDEVHDQRVVIKLNIHVGNTSLVDQIEWDMSEKENSAEKFAVRLCTELGLGGEFVTAIAYSIRGQLSWHQRTYAFSEAPLPVVEAPFRSHSESDQWSPFLETLTDAEMEKKIRDQDRNTRRMRRLANTTTGW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 Core component of the BAF (SWI/SNF) complex. This ATP-dependent chromatin-remodeling complex plays important roles in cell proliferation and differentiation, in cellular antiviral activities and inhibition of tumor formation. The BAF complex is able to create a stable, altered form of chromatin that constrains fewer negative supercoils than normal. This change in supercoiling would be due to the conversion of up to one-half of the nucleosomes on polynucleosomal arrays into asymmetric structures, termed altosomes, each composed of 2 histones octamers. Stimulates in vitro the remodeling activity of SMARCA4/BRG1/BAF190A. Plays a key role in cell-cycle control and causes cell cycle arrest in G0/G1. Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene (By similarity). Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.confidentQ9Z0H3
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 Core component of the BAF (hSWI/SNF) complex. This ATP-dependent chromatin-remodeling complex plays important roles in cell proliferation and differentiation, in cellular antiviral activities and inhibition of tumor formation. The BAF complex is able to create a stable, altered form of chromatin that constrains fewer negative supercoils than normal. This change in supercoiling would be due to the conversion of up to one-half of the nucleosomes on polynucleosomal arrays into asymmetric structures, termed altosomes, each composed of 2 histones octamers. Stimulates in vitro the remodeling activity of SMARCA4/BRG1/BAF190A. Involved in activation of CSF1 promoter. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity). Plays a key role in cell-cycle control and causes cell cycle arrest in G0/G1. Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.confidentQ12824
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1-A Involved in chromatin-remodeling. Part of a complex that opens the chromatin to facilitate the transcriptional machinery to access their targets. Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR).confidentQ5U379

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016514 [CC]SWI/SNF complexprobableGO:0043234, GO:0005575, GO:0070603, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0032991, GO:0090544, GO:0043227, GO:0043226, GO:0044422
GO:0070983 [BP]dendrite guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0006928, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048813, GO:0048812, GO:0008150
GO:0070984 [MF]SET domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0030957 [MF]Tat protein bindingprobableGO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0008285 [BP]negative regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0043923 [BP]positive regulation by host of viral transcriptionprobableGO:0009893, GO:0019222, GO:0031328, GO:2000243, GO:0031325, GO:2000241, GO:0031323, GO:0044403, GO:0052472, GO:0050434, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:0051851, GO:0044419, GO:0019219, GO:0051817, GO:0046782, GO:0031326, GO:0048518, GO:0065007, GO:0065008, GO:0045935, GO:0060255, GO:0050792, GO:0009889, GO:0050794, GO:0043902, GO:0043900, GO:0008150, GO:0043921, GO:2001141, GO:0051702, GO:0051704, GO:0052312, GO:0051173, GO:0051252, GO:0051254, GO:0010557, GO:0010556, GO:0048524, GO:0035821, GO:0048522
GO:0006338 [BP]chromatin remodelingprobableGO:0006996, GO:0051276, GO:0006325, GO:0071840, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0016568
GO:0006337 [BP]nucleosome disassemblyprobableGO:0034728, GO:0032986, GO:0032984, GO:0071824, GO:0051276, GO:0006325, GO:0009987, GO:0044763, GO:0006333, GO:0016043, GO:0008150, GO:0043933, GO:0022411, GO:0071840, GO:0006996, GO:0031498, GO:0044699
GO:0007474 [BP]imaginal disc-derived wing vein specificationprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0003002, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0008587 [BP]imaginal disc-derived wing margin morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0008544 [BP]epidermis developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0071565 [CC]nBAF complexprobableGO:0043234, GO:0044446, GO:0070603, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0097458, GO:0043229, GO:0044428, GO:0044424, GO:0032991, GO:0090544, GO:0043227, GO:0043226, GO:0044422
GO:0071564 [CC]npBAF complexprobableGO:0043234, GO:0005575, GO:0070603, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0032991, GO:0090544, GO:0043227, GO:0043226, GO:0044422
GO:0002039 [MF]p53 bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0008586 [BP]imaginal disc-derived wing vein morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0001741 [CC]XY bodyprobableGO:0043232, GO:0044464, GO:0000803, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0007517 [BP]muscle organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0007275, GO:0044699
GO:0003713 [MF]transcription coactivator activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0051091 [BP]positive regulation of sequence-specific DNA binding transcription factor activityprobableGO:0009889, GO:0051090, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:0044093, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0045090 [BP]retroviral genome replicationprobableGO:0044703, GO:0000003, GO:0019079, GO:0009987, GO:0044764, GO:0022415, GO:0022414, GO:0019058, GO:0008150, GO:0016032, GO:0051704

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LRU, chain A
Confidence level:probable
Coverage over the Query: 521-568
View the alignment between query and template
View the model in PyMOL
Template: 2K89, chain A
Confidence level:probable
Coverage over the Query: 448-490
View the alignment between query and template
View the model in PyMOL