Diaphorina citri psyllid: psy13561


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MALSNDYFQCGWNIFDLIVVTASLVDLMTEFVDGLSVLRGLRLSWTTMKVLLSIIISTIGALGNLTFVLVIVIYIFAVIGMQLFSKDYTSEKFAPDPVP
ccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc
*ALSNDYFQCGWNIFDLIVVTASLVDLMTEFVDGLSVLRGLRLSWTTMKVLLSIIISTIGALGNLTFVLVIVIYIFAVIGMQLFSKDYTSEKFAP****
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALSNDYFQCGWNIFDLIVVTASLVDLMTEFVDGLSVLRGLRLSWTTMKVLLSIIISTIGALGNLTFVLVIVIYIFAVIGMQLFSKDYTSEKFAPDPVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium channel protein 60E Mediates the voltage-dependent sodium ion permeability of excitable membranes. Plays a role in processing of olfactory information during the olfactory avoidance response.confidentQ9W0Y8
Sodium channel protein type 4 subunit alpha B This protein mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. This sodium channel may be present in both denervated and innervated skeletal muscle.confidentQ20JQ7
Sodium channel protein type 9 subunit alpha Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-sensitive Na(+) channel isoform. Plays a role in pain mechanisms, especially in the development of inflammatory pain.confidentQ15858

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031402 [MF]sodium ion bindingprobableGO:0043169, GO:0031420, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0044325 [MF]ion channel bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0086070 [BP]SA node cell to atrial cardiac muscle cell communicationprobableGO:0065007, GO:0044700, GO:0009987, GO:0061337, GO:0035637, GO:0032501, GO:0008016, GO:0050789, GO:0051239, GO:0044057, GO:0044763, GO:0008150, GO:0023052, GO:0007154, GO:0086065, GO:0044707, GO:0044699
GO:0009605 [BP]response to external stimulusprobableGO:0050896, GO:0008150
GO:0060307 [BP]regulation of ventricular cardiac muscle cell membrane repolarizationprobableGO:0042391, GO:0051049, GO:0050801, GO:0055082, GO:0060306, GO:0032844, GO:0042592, GO:0001508, GO:0034765, GO:0050789, GO:0034762, GO:0051234, GO:0086001, GO:0086009, GO:0051179, GO:0065007, GO:0043269, GO:0065008, GO:0019725, GO:0006810, GO:0006811, GO:0009987, GO:0006873, GO:0050794, GO:0034220, GO:0044765, GO:0008150, GO:0086013, GO:0086011, GO:0032879, GO:0055085, GO:0044699, GO:0086036, GO:0048878, GO:2000021, GO:0044763
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0007628 [BP]adult walking behaviorprobableGO:0007626, GO:0032501, GO:0044707, GO:0030534, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0008344, GO:0044699
GO:0060371 [BP]regulation of atrial cardiac muscle cell membrane depolarizationprobableGO:0042391, GO:0050801, GO:0032844, GO:0042592, GO:0051899, GO:0001508, GO:0050789, GO:0044699, GO:0086001, GO:0065007, GO:0065008, GO:0019725, GO:0009987, GO:0006873, GO:0050794, GO:0044763, GO:0086012, GO:0055082, GO:0086010, GO:0086036, GO:0003254, GO:0048878, GO:2000021, GO:0008150
GO:0086069 [BP]bundle of His cell to Purkinje myocyte communicationprobableGO:0065007, GO:0044700, GO:0009987, GO:0061337, GO:0035637, GO:0032501, GO:0008016, GO:0050789, GO:0051239, GO:0044057, GO:0044763, GO:0008150, GO:0023052, GO:0007154, GO:0086065, GO:0044707, GO:0044699
GO:0050905 [BP]neuromuscular processprobableGO:0032501, GO:0044707, GO:0050877, GO:0008150, GO:0044699, GO:0003008
GO:0086067 [BP]AV node cell to bundle of His cell communicationprobableGO:0065007, GO:0044700, GO:0009987, GO:0061337, GO:0035637, GO:0032501, GO:0008016, GO:0050789, GO:0051239, GO:0044057, GO:0044763, GO:0008150, GO:0023052, GO:0007154, GO:0086065, GO:0044707, GO:0044699
GO:0046684 [BP]response to pyrethroidprobableGO:0008150, GO:0042221, GO:0050896, GO:0009636, GO:0017085
GO:0005248 [MF]voltage-gated sodium channel activityprobableGO:0005261, GO:0003674, GO:0015081, GO:0015077, GO:0022843, GO:0022803, GO:0046873, GO:0005272, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0022836, GO:0022839, GO:0022838
GO:0007600 [BP]sensory perceptionprobableGO:0032501, GO:0044707, GO:0050877, GO:0008150, GO:0044699, GO:0003008
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0060373 [BP]regulation of ventricular cardiac muscle cell membrane depolarizationprobableGO:0042391, GO:0050801, GO:0032844, GO:0042592, GO:0051899, GO:0001508, GO:0050789, GO:0044699, GO:0086001, GO:0065007, GO:0065008, GO:0019725, GO:0009987, GO:0006873, GO:0050794, GO:0044763, GO:0086012, GO:0055082, GO:0086010, GO:0086036, GO:0003254, GO:0048878, GO:2000021, GO:0008150
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0002027 [BP]regulation of heart rateprobableGO:0044057, GO:0008016, GO:0008150, GO:0051239, GO:0065007, GO:0065008, GO:0050789
GO:0010765 [BP]positive regulation of sodium ion transportprobableGO:0010959, GO:0051050, GO:0051049, GO:0043270, GO:0065007, GO:0002028, GO:0048518, GO:0008150, GO:0032879, GO:0050789, GO:0043269
GO:0042048 [BP]olfactory behaviorprobableGO:0007635, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0042221
GO:0035725 [BP]sodium ion transmembrane transportprobableGO:0009987, GO:0051234, GO:0006812, GO:0006811, GO:0006810, GO:0055085, GO:0008150, GO:0034220, GO:0044765, GO:0030001, GO:0044763, GO:0051179, GO:0006814, GO:0015672, GO:0044699
GO:0043194 [CC]axon initial segmentprobableGO:0044304, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0097110 [MF]scaffold protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030506 [MF]ankyrin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005516 [MF]calmodulin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0006816 [BP]calcium ion transportprobableGO:0072511, GO:0006812, GO:0006811, GO:0006810, GO:0008150, GO:0044765, GO:0030001, GO:0070838, GO:0051234, GO:0051179, GO:0044699
GO:0060048 [BP]cardiac muscle contractionprobableGO:0032501, GO:0044707, GO:0006936, GO:0008015, GO:0006941, GO:0003012, GO:0060047, GO:0008150, GO:0003015, GO:0003013, GO:0044699, GO:0003008
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0030315 [CC]T-tubuleprobableGO:0042383, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0001518 [CC]voltage-gated sodium channel complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0034706, GO:0071944, GO:0034702, GO:0034703, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0060372 [BP]regulation of atrial cardiac muscle cell membrane repolarizationprobableGO:0042391, GO:0051049, GO:0050801, GO:0055082, GO:0060306, GO:0032844, GO:0042592, GO:0001508, GO:0034765, GO:0050789, GO:0034762, GO:0051234, GO:0086001, GO:0086009, GO:0051179, GO:0065007, GO:0043269, GO:0065008, GO:0019725, GO:0006810, GO:0006811, GO:0009987, GO:0006873, GO:0050794, GO:0034220, GO:0044765, GO:0008150, GO:0086013, GO:0086011, GO:0032879, GO:0055085, GO:0044699, GO:0086036, GO:0048878, GO:2000021, GO:0044763
GO:0019228 [BP]regulation of action potential in neuronprobableGO:0042391, GO:0019226, GO:0035637, GO:0050801, GO:0042592, GO:0023052, GO:0001508, GO:0044699, GO:0065007, GO:0065008, GO:0019725, GO:0032501, GO:0050877, GO:0009987, GO:0006873, GO:0008150, GO:0007154, GO:0055082, GO:0003008, GO:0044700, GO:0044707, GO:0048878, GO:0044763
GO:0071236 [BP]cellular response to antibioticprobableGO:0051716, GO:0097237, GO:0009987, GO:0009636, GO:0008150, GO:0044763, GO:0046677, GO:0070887, GO:0042221, GO:0050896, GO:0044699
GO:0071277 [BP]cellular response to calcium ionprobableGO:0051716, GO:0071248, GO:0010038, GO:0050896, GO:0009987, GO:0071241, GO:0051592, GO:0044763, GO:0008150, GO:0070887, GO:0042221, GO:0010035, GO:0044699
GO:0033268 [CC]node of RanvierprobableGO:0044304, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0005245 [MF]voltage-gated calcium channel activityprobableGO:0005261, GO:0005262, GO:0003674, GO:0015085, GO:0072509, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0022836, GO:0022839, GO:0022838
GO:0001666 [BP]response to hypoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0086005 [BP]regulation of ventricular cardiac muscle cell action potentialprobableGO:0042391, GO:0050801, GO:0042592, GO:0006942, GO:0001508, GO:0050789, GO:0044699, GO:0086004, GO:0086001, GO:0086002, GO:0065007, GO:0065008, GO:0019725, GO:0008016, GO:0006937, GO:0032970, GO:0006873, GO:0050794, GO:0008150, GO:0090257, GO:0051239, GO:0055082, GO:0032879, GO:0055117, GO:0051270, GO:0044057, GO:0086036, GO:0048878, GO:0044763, GO:0009987
GO:0007399 [BP]nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DXW, chain A
Confidence level:very confident
Coverage over the Query: 7-94
View the alignment between query and template
View the model in PyMOL