Diaphorina citri psyllid: psy13573


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MVTGHLLFWSLSLWAVGQSGIFGPHAPLLEMMLFAALISAVDPVAVLAVFEEIHVNEILYIVVFGESLLNDAVTVVLYHMFEAYTEMGHNNVLYVDLLSGLASFFVVAVGGTVIGVIWGFLTGFVTRFTNEVRVIEPIFIFVMAYLAYLTAEIFHMSGILAIAELY
ccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHEEHHHcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcc
MVTGHLLFWSLSLWAVGQSGIFGPHAPLLEMMLFAALISAVDPVAVLAVFEEIHVNEILYIVVFGESLLNDAVTVVLYHMFEAYTEMGHNNVLYVDLLSGLASFFVVAVGGTVIGVIWGFLTGFVTRFTNEVRVIEPIFIFVMAYLAYLTAEIFHMSGILAIAELY
xxxxxxxxxxxxxxHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTGHLLFWSLSLWAVGQSGIFGPHAPLLEMMLFAALISAVDPVAVLAVFEEIHVNEILYIVVFGESLLNDAVTVVLYHMFEAYTEMGHNNVLYVDLLSGLASFFVVAVGGTVIGVIWGFLTGFVTRFTNEVRVIEPIFIFVMAYLAYLTAEIFHMSGILAIAELY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable Na(+)/H(+) antiporter nhx-9 Serves some physiological function other than regulation of cellular pH.confidentP35449
Sodium/hydrogen exchanger 5 Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction.confidentQ14940

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0015992 [BP]proton transportprobableGO:0006818, GO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0051453 [BP]regulation of intracellular pHprobableGO:0019725, GO:0044699, GO:0006885, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0030004, GO:0065007, GO:0044763, GO:0055067, GO:0030003, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0030641
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0055037 [CC]recycling endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0015385 [MF]sodium:hydrogen antiporter activityprobableGO:0022891, GO:0022890, GO:0015297, GO:0022892, GO:0015291, GO:0015081, GO:0015491, GO:0005215, GO:0008324, GO:0015299, GO:0015298, GO:0015075, GO:0022857, GO:0015077, GO:0003674, GO:0046873, GO:0005451, GO:0015078, GO:0022804
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0035725 [BP]sodium ion transmembrane transportprobableGO:0009987, GO:0051234, GO:0006812, GO:0006811, GO:0006810, GO:0055085, GO:0008150, GO:0034220, GO:0044765, GO:0030001, GO:0044763, GO:0051179, GO:0006814, GO:0015672, GO:0044699
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0010447 [BP]response to acidityprobableGO:0009268, GO:0050896, GO:0008150, GO:0009628
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0031526 [CC]brush border membraneprobableGO:0016020, GO:0044464, GO:0044463, GO:0031253, GO:0005623, GO:0005575, GO:0005903, GO:0071944, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0014070 [BP]response to organic cyclic compoundprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0001101 [BP]response to acidprobableGO:0042221, GO:0050896, GO:0008150
GO:0048306 [MF]calcium-dependent protein bindingprobableGO:0003674, GO:0005488, GO:0005515

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0E, chain A
Confidence level:confident
Coverage over the Query: 27-57
View the alignment between query and template
View the model in PyMOL
Template: 2HTG, chain A
Confidence level:confident
Coverage over the Query: 54-79
View the alignment between query and template
View the model in PyMOL
Template: 2K3C, chain A
Confidence level:probable
Coverage over the Query: 143-164
View the alignment between query and template
View the model in PyMOL