Diaphorina citri psyllid: psy13574


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MFVTTTIAVIYFTVFFQGITIKPLVKILNVKTAERRKPSMNERIHERLMDHVMAGIEDILGRHGNHHVRDRFKRFDNRFIRPYLLRDHQQGAEPKILETYSKLAMKDAMEFMRRNASTIGGGSITGTDSMSAIFRNYTTGHLNGR
ccEEEEEEEEEEEHHHccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHcccccccccc
MFVTTTIAVIYFTVFFQGITIKPLVKILNVKT***********IHERLMDHVMAGIEDILGRHGNHHVRDRFKRFDNRFIRPYLLRDHQQGAEPKILETYSKLAMKDAM*F**********************************
xxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVTTTIAVIYFTVFFQGITIKPLVKILNVKTAERRKPSMNERIHERLMDHVMAGIEDILGRHGNHHVRDRFKRFDNRFIRPYLLRDHQQGAEPKILETYSKLAMKDAMEFMRRNASTIGGGSITGTDSMSAIFRNYTTGHLNGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium/hydrogen exchanger 4 Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction. May play a specialized role in the kidney in rectifying cell volume in response to extreme fluctuations of hyperosmolar-stimulated cell shrinkage. Is relatively amiloride and ethylisopropylamiloride (EIPA) insensitive. Can be activated under conditions of hyperosmolar-induced cell shrinkage in a sustained intracellular acidification-dependence manner. Activated by 4,4'-diisothiocyanostilbene-2,2'-disulfonic acid (DIDS) in a sustained intracellular acidification-dependence manner. Affects potassium/proton exchange as well as sodium/proton and lithium/proton exchange. In basolateral cell membrane, participates in homeostatic control of intracellular pH, and may play a role in proton extrusion in order to achieve transepithelial HCO3(-) secretion. In apical cell membrane may be involved in mediating sodium absorption. Requires for normal levels of gastric acid secretion, secretory membrane development, parietal cell maturation and/or differentiation and at least secondarily for chief cell differentiation.confidentP26434

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009628 [BP]response to abiotic stimulusprobableGO:0050896, GO:0008150
GO:0006814 [BP]sodium ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0006873 [BP]cellular ion homeostasisprobableGO:0019725, GO:0050801, GO:0009987, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BEC, chain B
Confidence level:very confident
Coverage over the Query: 38-62
View the alignment between query and template
View the model in PyMOL