Diaphorina citri psyllid: psy13577


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MKLLGAFVVTLVVAVAIAKEEKNGVFYKEPSRGVNPDEAVAYGAAVQAGVLSGEQDTDAIVLLDVNPLIPAVDAH
cccccccEEHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccEEEEEcccccccEEcc
*KLLGAFVVTLVVAVAIAKEEKNGVFYKEPSRGVNPDEAVAYGAAVQAGVLSGEQDTDAIVLLDVNPLIPAVD**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLLGAFVVTLVVAVAIAKEEKNGVFYKEPSRGVNPDEAVAYGAAVQAGVLSGEQDTDAIVLLDVNPLIPAVDAH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable mediator of RNA polymerase II transcription subunit 37b In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.confidentQ8H1B3
Heat shock 70 kDa protein cognate 3 Probably plays a role in facilitating the assembly of multimeric protein complexes inside the ER.confidentP29844
78 kDa glucose-regulated protein Probably plays a role in facilitating the assembly of multimeric protein complexes inside the ER.confidentP06761

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005788 [CC]endoplasmic reticulum lumenprobableGO:0005737, GO:0005575, GO:0005783, GO:0043233, GO:0044464, GO:0043229, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0005623, GO:0044424, GO:0044432, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0003674 [MF]molecular_functionprobable
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0071704 [BP]organic substance metabolic processprobableGO:0008150, GO:0008152
GO:0044238 [BP]primary metabolic processprobableGO:0008150, GO:0008152
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YUW, chain A
Confidence level:very confident
Coverage over the Query: 9-74
View the alignment between query and template
View the model in PyMOL