Diaphorina citri psyllid: psy13592


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-
MSGIAQMSPYNQMNHNVMQSFNNWYQNQTFHPNQYYEPYNNNCPTKSEPNPCQYEDRDARYFEKDAKYFAKDANSFDKDPAKYYDNFLDHNTMNYNHMNAFNQFHMKSNPNHTDYLRTNSDKETLNATNFVPKDEAISEMVDGKPPGFNMDRNGNPVGLRADSNGVGSPDVQDSCSVSSQQDHEGEDGATLYPWMKSNHDASYSCKTGGGNKRSRQTYSRYQTLELEKEFHYNKYLSRKRRIEIAHELQLTERQIKIWFQNRRMKLKKEVLRPNISSTTMLDEKLEAPPVFMPAYSAALPKANYDWNGSQIGEVGSTEMSM
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccc
****************VMQSFNNWYQNQTFHPNQYYEPYNN*****************ARYFEKDAKYFAKDANSFDKDPAKYYDNFLDHNTMNYNHMNAFNQFH***************************************************************************************************************TYSRYQTLELEKEFHYNKYLSRKRRIEIAHELQLTERQIKIWFQNRRMKLKKE****************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGIAQMSPYNQMNHNVMQSFNNWYQNQTFHPNQYYEPYNNNCPTKSEPNPCQYEDRDARYFEKDAKYFAKDANSFDKDPAKYYDNFLDHNTMNYNHMNAFNQFHMKSNPNHTDYLRTNSDKETLNATNFVPKDEAISEMVDGKPPGFNMDRNGNPVGLRADSNGVGSPDVQDSCSVSSQQDHEGEDGATLYPWMKSNHDASYSCKTGGGNKRSRQTYSRYQTLELEKEFHYNKYLSRKRRIEIAHELQLTERQIKIWFQNRRMKLKKEVLRPNISSTTMLDEKLEAPPVFMPAYSAALPKANYDWNGSQIGEVGSTEMSM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox protein Hox-B7 Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.confidentP09629
Homeobox protein Hox-B7 Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.confidentP09024
Homeobox protein Hox-B7 Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.confidentQ9TT89

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0002686 [BP]negative regulation of leukocyte migrationprobableGO:0030336, GO:0040013, GO:0030334, GO:2000145, GO:0065007, GO:0051271, GO:0051270, GO:0008150, GO:0040012, GO:0002685, GO:0002682, GO:0002683, GO:2000146, GO:0048519, GO:0032879, GO:0050794, GO:0050789, GO:0048523
GO:0048704 [BP]embryonic skeletal system morphogenesisprobableGO:0048705, GO:0048598, GO:0009887, GO:0048562, GO:0044707, GO:0048513, GO:0009790, GO:0048568, GO:0032501, GO:0048856, GO:0044767, GO:0001501, GO:0048706, GO:0008150, GO:0009792, GO:0048731, GO:0043009, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0048863 [BP]stem cell differentiationprobableGO:0032502, GO:0030154, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0009952 [BP]anterior/posterior pattern specificationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045617 [BP]negative regulation of keratinocyte differentiationprobableGO:0051093, GO:0051239, GO:0050793, GO:0048519, GO:0050794, GO:0008150, GO:0045596, GO:0045595, GO:0065007, GO:0030856, GO:0030857, GO:0045605, GO:0045604, GO:0045683, GO:0045682, GO:0045616, GO:0050789, GO:0048523, GO:2000026
GO:0001525 [BP]angiogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0048646, GO:0048731, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0045656 [BP]negative regulation of monocyte differentiationprobableGO:0002761, GO:0051093, GO:0002762, GO:0045596, GO:0050793, GO:0050789, GO:0045655, GO:0050794, GO:1902105, GO:1902106, GO:0045638, GO:0065007, GO:0002682, GO:0008150, GO:0051239, GO:0048519, GO:2000026, GO:0045595, GO:0045637, GO:0048523
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0001953 [BP]negative regulation of cell-matrix adhesionprobableGO:0010810, GO:0030155, GO:0001952, GO:0050794, GO:0050789, GO:0007162, GO:0065007, GO:0008150, GO:0048519, GO:0010812, GO:0048523
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B72, chain A
Confidence level:very confident
Coverage over the Query: 189-197,214-272
View the alignment between query and template
View the model in PyMOL