Psyllid ID: psy13592


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-
MSGIAQMSPYNQMNHNVMQSFNNWYQNQTFHPNQYYEPYNNNCPTKSEPNPCQYEDRDARYFEKDAKYFAKDANSFDKDPAKYYDNFLDHNTMNYNHMNAFNQFHMKSNPNHTDYLRTNSDKETLNATNFVPKDEAISEMVDGKPPGFNMDRNGNPVGLRADSNGVGSPDVQDSCSVSSQQDHEGEDGATLYPWMKSNHDASYSCKTGGGNKRSRQTYSRYQTLELEKEFHYNKYLSRKRRIEIAHELQLTERQIKIWFQNRRMKLKKEVLRPNISSTTMLDEKLEAPPVFMPAYSAALPKANYDWNGSQIGEVGSTEMSM
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccHHHccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcccHEEccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcHHccccccccccccccccccccccccccccccccccccccccccccccccccccc
msgiaqmspynqmNHNVMQSFNnwyqnqtfhpnqyyepynnncptksepnpcqyedrdARYFEKDAKYFAkdansfdkdpakyydnfldhntmnynhmnafnqfhmksnpnhtdylrtnsdketlnatnfvpkdeaisemvdgkppgfnmdrngnpvglradsngvgspdvqdscsvssqqdhegedgatlypwmksnhdasyscktgggnkrsrqtySRYQTLELEKEFHYNKYLSRKRRIEIAHELQLTERQIKIWFQNRRMKLKKevlrpnissttmldekleappvfmpaysaalpkanydwngsqigevgstemsm
msgiaqmspyNQMNHNVMQSFNNWYQNQTFHPNQYYEPYNNNCPTKSEPNPCQYEDRDARYFEKDAKYFAkdansfdkdpAKYYDNFLDHNTMNYNHMNAFNQFHMKSNPNHTDYLRTNSDKETLNATnfvpkdeaisEMVDGKPPGFNMDRNGNPVGLRADSNGVGSPDVQDSCSVSSQQDHEGEDGATLYPWMKSNHDASyscktgggnkrsrqtYSRYQTLELEKEFHYNKYLSRKRRIEIAhelqlterqikiwfqnrrmklkkevlrpnissttmldekleAPPVFMPAYSAALPKANYDWNGSQIgevgstemsm
MSGIAQMSPYNQMNHNVMQSFNNWYQNQTFHPNQYYEPYNNNCPTKSEPNPCQYEDRDARYFEKDAKYFAKDANSFDKDPAKYYDNFLDHNTMNYNHMNAFNQFHMKSNPNHTDYLRTNSDKETLNATNFVPKDEAISEMVDGKPPGFNMDRNGNPVGLRADSNGVGspdvqdscsvssqqdHEGEDGATLYPWMKSNHDASYSCKTGGGNKRSRQTYSRYQTLELEKEFHYNKYLSRKRRIEIAHELQLTERQIKIWFQNRRMKLKKEVLRPNISSTTMLDEKLEAPPVFMPAYSAALPKANYDWNGSQIGEVGSTEMSM
****************VMQSFNNWYQNQTFHPNQYYEPYNN*****************ARYFEKDAKYFAKDANSFDKDPAKYYDNFLDHNTMNYNHMNAFNQFH*****************************************************************************************************************SRYQTLELEKEFHYNKYLSRKRRIEIAHELQLTERQIKIWFQNRRMKLKKEVLR****************PVFMPAYSAALPKANYDWN**************
************************************************************************************************************************************************************************************************************************TYSRYQTLELEKEFHYNKYLSRKRRIEIAHELQLTERQIKIWFQNRRM*********************************************************
MSGIAQMSPYNQMNHNVMQSFNNWYQNQTFHPNQYYEPYNNNCPTKSEPNPCQYEDRDARYFEKDAKYFAKDANSFDKDPAKYYDNFLDHNTMNYNHMNAFNQFHMKSNPNHTDYLRTNSDKETLNATNFVPKDEAISEMVDGKPPGFNMDRNGNPVGLRADSN*********************EDGATLYPWMKSNHDASYS************TYSRYQTLELEKEFHYNKYLSRKRRIEIAHELQLTERQIKIWFQNRRMKLKKEVLRPNISSTTMLDEKLEAPPVFMPAYSAALPKANYDWNGSQIGEVGSTEMSM
********P******NVMQSFNNWYQNQTFHPNQYYEPYNNNCPTKSEPNPCQYEDRDARYFEKDAKYFAKDANSFDKDPAKYYDNFLDHNTMNYNHMNAFNQFHMKSNPNHTDYLRTNSDKET***************************************************************GATLYPWMKSNHDA************SRQTYSRYQTLELEKEFHYNKYLSRKRRIEIAHELQLTERQIKIWFQNRRMKLKKE****************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGIAQMSPYNQMNHNVMQSFNNWYQNQTFHPNQYYEPYNNNCPTKSEPNPCQYEDRDARYFEKDAKYFAKDANSFDKDPAKYYDNFLDHNTMNYNHMNAFNQFHMKSNPNHTDYLRTNSDKETLNATNFVPKDEAISEMVDGKPPGFNMDRNGNPVGLRADSNGVGSPDVQDSCSVSSQQDHEGEDGATLYPWMKSNHDASYSCKTGGGNKRSRQTYSRYQTLELEKEFHYNKYLSRKRRIEIAHELQLTERQIKIWFQNRRMKLKKEVLRPNISSTTMLDEKLEAPPVFMPAYSAALPKANYDWNGSQIGEVGSTEMSM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query321 2.2.26 [Sep-21-2011]
Q8AWY9227 Homeobox protein Hox-B7a yes N/A 0.233 0.330 0.702 1e-27
P04476220 Homeobox protein Hox-B7-B N/A N/A 0.280 0.409 0.603 2e-27
A1YFA5217 Homeobox protein Hox-B7 O N/A N/A 0.302 0.447 0.574 2e-27
Q9TT89217 Homeobox protein Hox-B7 O yes N/A 0.302 0.447 0.574 3e-27
P09077417 Homeotic protein Sex comb yes N/A 0.246 0.189 0.683 3e-27
P09629217 Homeobox protein Hox-B7 O yes N/A 0.302 0.447 0.574 3e-27
P02833378 Homeotic protein antennap no N/A 0.358 0.304 0.527 4e-27
P18864219 Homeobox protein Hox-B7 O yes N/A 0.302 0.442 0.574 4e-27
P09024217 Homeobox protein Hox-B7 O yes N/A 0.302 0.447 0.574 5e-27
Q91771220 Homeobox protein Hox-B7-A N/A N/A 0.292 0.427 0.594 1e-26
>sp|Q8AWY9|HXB7A_DANRE Homeobox protein Hox-B7a OS=Danio rerio GN=hoxb7a PE=2 SV=1 Back     alignment and function desciption
 Score =  123 bits (309), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 65/84 (77%), Gaps = 9/84 (10%)

Query: 186 EDGATLYPWMKSNHDASYSCKTGGGNKRSRQTYSRYQTLELEKEFHYNKYLSRKRRIEIA 245
           E+   +YPWM+S         TG   KR RQTYSRYQTLELEKEFH+N+YLSR+RRIEIA
Sbjct: 129 ENNLRIYPWMRS---------TGADRKRGRQTYSRYQTLELEKEFHFNRYLSRRRRIEIA 179

Query: 246 HELQLTERQIKIWFQNRRMKLKKE 269
           H L LTERQIKIWFQNRRMK KKE
Sbjct: 180 HALCLTERQIKIWFQNRRMKWKKE 203




Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Danio rerio (taxid: 7955)
>sp|P04476|HXB7B_XENLA Homeobox protein Hox-B7-B OS=Xenopus laevis GN=hoxb7-b PE=2 SV=1 Back     alignment and function description
>sp|A1YFA5|HXB7_GORGO Homeobox protein Hox-B7 OS=Gorilla gorilla gorilla GN=HOXB7 PE=3 SV=1 Back     alignment and function description
>sp|Q9TT89|HXB7_BOVIN Homeobox protein Hox-B7 OS=Bos taurus GN=HOXB7 PE=2 SV=1 Back     alignment and function description
>sp|P09077|SCR_DROME Homeotic protein Sex combs reduced OS=Drosophila melanogaster GN=Scr PE=1 SV=5 Back     alignment and function description
>sp|P09629|HXB7_HUMAN Homeobox protein Hox-B7 OS=Homo sapiens GN=HOXB7 PE=1 SV=4 Back     alignment and function description
>sp|P02833|ANTP_DROME Homeotic protein antennapedia OS=Drosophila melanogaster GN=Antp PE=1 SV=1 Back     alignment and function description
>sp|P18864|HXB7_RAT Homeobox protein Hox-B7 OS=Rattus norvegicus GN=Hoxb7 PE=2 SV=2 Back     alignment and function description
>sp|P09024|HXB7_MOUSE Homeobox protein Hox-B7 OS=Mus musculus GN=Hoxb7 PE=2 SV=2 Back     alignment and function description
>sp|Q91771|HXB7A_XENLA Homeobox protein Hox-B7-A OS=Xenopus laevis GN=hoxb7-a PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query321
312125843369 fushi tarazu [Thermobia domestica] 0.417 0.363 0.509 1e-29
15450325290 homeodomain transcription factor Fushi t 0.327 0.362 0.581 9e-28
86515424290 fushi tarazu [Tribolium castaneum] gi|13 0.327 0.362 0.581 1e-27
541626322 fushi-tarazu [Tribolium castaneum] gi|10 0.327 0.326 0.581 1e-27
225717090215 Homeobox protein Hox-B7a [Esox lucius] 0.286 0.427 0.611 2e-27
70569917220 transcription factor protein [Ciona inte 0.442 0.645 0.48 3e-27
74096097220 Hox 5 [Ciona intestinalis] gi|2564231|em 0.442 0.645 0.48 3e-27
358332706 733 homeobox protein SMOX-1 [Clonorchis sine 0.654 0.286 0.356 5e-27
312125839368 fushi tarazu [Callosobruchus maculatus] 0.336 0.293 0.534 8e-27
224086908217 PREDICTED: homeobox protein Hox-B7 isofo 0.286 0.423 0.625 9e-27
>gi|312125843|gb|ADQ27865.1| fushi tarazu [Thermobia domestica] Back     alignment and taxonomy information
 Score =  136 bits (342), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/151 (50%), Positives = 94/151 (62%), Gaps = 17/151 (11%)

Query: 147 GFNMDRNGNPVGLRADSNGVGSPD-----VQDSCSVSS-----QQDHEGEDGATLYPWMK 196
           G ++  NG  V      N +G PD     VQ    V+      QQ   G+  A  +PWMK
Sbjct: 167 GRDLIANGCKVSSFCAPNNIGVPDSSSLMVQQGFDVTRPLDCLQQPFVGKGPANYFPWMK 226

Query: 197 SNHDASYSCKTGGGNKRSRQTYSRYQTLELEKEFHYNKYLSRKRRIEIAHELQLTERQIK 256
           S  D      TG G KR+RQTY+R+QTLELEKEFH+NKYL+R+RRIEIAH L L+ERQIK
Sbjct: 227 SYTD------TGHGPKRTRQTYTRFQTLELEKEFHFNKYLTRRRRIEIAHSLGLSERQIK 280

Query: 257 IWFQNRRMKLKKEV-LRPNISSTTMLDEKLE 286
           IWFQNRRMK KKE+ ++P   S    D+ LE
Sbjct: 281 IWFQNRRMKAKKEIKMQPQPVSNGTEDDILE 311




Source: Thermobia domestica

Species: Thermobia domestica

Genus: Thermobia

Family: Lepismatidae

Order:

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|15450325|gb|AAK96032.1| homeodomain transcription factor Fushi tarazu [Tribolium castaneum] gi|270002804|gb|EEZ99251.1| fushi tarazu [Tribolium castaneum] Back     alignment and taxonomy information
>gi|86515424|ref|NP_001034539.1| fushi tarazu [Tribolium castaneum] gi|13241680|gb|AAK16421.1|AF321227_1 Ftz [Tribolium castaneum] Back     alignment and taxonomy information
>gi|541626|gb|AAC46491.1| fushi-tarazu [Tribolium castaneum] gi|1093401|prf||2103337A fushi tarazu gene Back     alignment and taxonomy information
>gi|225717090|gb|ACO14391.1| Homeobox protein Hox-B7a [Esox lucius] Back     alignment and taxonomy information
>gi|70569917|dbj|BAE06502.1| transcription factor protein [Ciona intestinalis] Back     alignment and taxonomy information
>gi|74096097|ref|NP_001027665.1| Hox 5 [Ciona intestinalis] gi|2564231|emb|CAA05151.1| Hox 5 [Ciona intestinalis] Back     alignment and taxonomy information
>gi|358332706|dbj|GAA30037.2| homeobox protein SMOX-1 [Clonorchis sinensis] Back     alignment and taxonomy information
>gi|312125839|gb|ADQ27863.1| fushi tarazu [Callosobruchus maculatus] Back     alignment and taxonomy information
>gi|224086908|ref|XP_002187141.1| PREDICTED: homeobox protein Hox-B7 isoform 1 [Taeniopygia guttata] gi|449491428|ref|XP_004174234.1| PREDICTED: homeobox protein Hox-B7 isoform 2 [Taeniopygia guttata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query321
MGI|MGI:96187224 Hoxb6 "homeobox B6" [Mus muscu 0.299 0.428 0.595 1.1e-29
RGD|1562142224 Hoxb6 "homeo box B6" [Rattus n 0.299 0.428 0.595 1.1e-29
ZFIN|ZDB-GENE-990415-106228 hoxb6a "homeo box B6a" [Danio 0.308 0.434 0.584 4.7e-29
UNIPROTKB|E2QT40224 HOXB6 "Uncharacterized protein 0.299 0.428 0.595 4.7e-29
UNIPROTKB|F6UVZ9232 HOXB6 "Uncharacterized protein 0.299 0.413 0.595 4.7e-29
UNIPROTKB|F1RWG1224 HOXB6 "Uncharacterized protein 0.299 0.428 0.595 5.9e-29
UNIPROTKB|P17509224 HOXB6 "Homeobox protein Hox-B6 0.242 0.348 0.696 9.6e-29
ZFIN|ZDB-GENE-000823-6276 hoxb5b "homeo box B5b" [Danio 0.283 0.329 0.6 6.6e-28
MGI|MGI:96208250 Hoxd4 "homeobox D4" [Mus muscu 0.267 0.344 0.655 1.7e-27
UNIPROTKB|F1RZG0257 HOXD4 "Uncharacterized protein 0.267 0.334 0.655 2.2e-27
MGI|MGI:96187 Hoxb6 "homeobox B6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 290 (107.1 bits), Expect = 1.1e-29, Sum P(2) = 1.1e-29
 Identities = 59/99 (59%), Positives = 73/99 (73%)

Query:   191 LYPWMKSNHDASYSCKTGGGNKRSRQTYSRYQTLELEKEFHYNKYLSRKRRIEIAHELQL 250
             +YPWM+  +  + S   G   +R RQTY+RYQTLELEKEFHYN+YL+R+RRIEIAH L L
Sbjct:   127 VYPWMQRMNSCN-SSSFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCL 185

Query:   251 TERQIKIWFQNRRMKLKKEVLRPNISSTTMLDEKLEAPP 289
             TERQIKIWFQNRRMK KKE     +S++ +  E+ E  P
Sbjct:   186 TERQIKIWFQNRRMKWKKE--SKLLSASQLSAEEEEEKP 222


GO:0003677 "DNA binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0007275 "multicellular organismal development" evidence=IEA
GO:0009952 "anterior/posterior pattern specification" evidence=IGI;IMP
GO:0034101 "erythrocyte homeostasis" evidence=IMP
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0048704 "embryonic skeletal system morphogenesis" evidence=IGI
GO:0048706 "embryonic skeletal system development" evidence=IGI;IMP
RGD|1562142 Hoxb6 "homeo box B6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-106 hoxb6a "homeo box B6a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2QT40 HOXB6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6UVZ9 HOXB6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWG1 HOXB6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P17509 HOXB6 "Homeobox protein Hox-B6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000823-6 hoxb5b "homeo box B5b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:96208 Hoxd4 "homeobox D4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZG0 HOXD4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P09629HXB7_HUMANNo assigned EC number0.57400.30210.4470yesN/A
P09024HXB7_MOUSENo assigned EC number0.57400.30210.4470yesN/A
Q9TT89HXB7_BOVINNo assigned EC number0.57400.30210.4470yesN/A
P18864HXB7_RATNo assigned EC number0.57400.30210.4429yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
pfam0004657 pfam00046, Homeobox, Homeobox domain 4e-28
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 1e-24
smart0038957 smart00389, HOX, Homeodomain 2e-24
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 1e-09
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
 Score =  103 bits (259), Expect = 4e-28
 Identities = 31/57 (54%), Positives = 41/57 (71%)

Query: 212 KRSRQTYSRYQTLELEKEFHYNKYLSRKRRIEIAHELQLTERQIKIWFQNRRMKLKK 268
           +R R T++  Q  ELEKEF  N+Y S + R E+A +L LTERQ+K+WFQNRR K K+
Sbjct: 1   RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNRRAKWKR 57


Length = 57

>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
2r5y_A88 Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO 4e-27
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 2e-25
1hom_A68 Determination Of The Three-Dimensional Structure Of 4e-22
1ahd_P68 Determination Of The Nmr Solution Structure Of An A 7e-22
9ant_A62 Antennapedia Homeodomain-Dna Complex Length = 62 7e-22
1ftz_A70 Nuclear Magnetic Resonance Solution Structure Of Th 5e-21
1san_A62 The Des(1-6)antennapedia Homeodomain: Comparison Of 6e-21
2h1k_A63 Crystal Structure Of The Pdx1 Homeodomain In Comple 4e-18
1b72_A97 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 7e-16
2lp0_A60 The Solution Structure Of Homeodomain-Protein Compl 8e-16
1puf_A77 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 2e-15
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 4e-14
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 2e-09
2djn_A70 The Solution Structure Of The Homeobox Domain Of Hu 2e-09
2cra_A70 Solution Structure Of The Homeobox Domain Of Human 2e-09
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 3e-09
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 3e-09
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 4e-09
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 5e-09
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 5e-09
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 5e-09
1jgg_A60 Even-Skipped Homeodomain Complexed To At-Rich Dna L 8e-09
2l9r_A69 Solution Nmr Structure Of Homeobox Domain Of Homeob 1e-08
1ztr_A61 Solution Structure Of Engrailed Homeodomain L16a Mu 1e-08
2e1o_A70 Solution Structure Of Rsgi Ruh-028, A Homeobox Doma 2e-08
2l7z_A73 Nmr Structure Of A13 Homedomain Length = 73 2e-08
1ig7_A58 Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 2e-08
2ld5_A67 Solution Nmr-Derived Complex Structure Of Hoxa13 Dn 2e-08
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 2e-08
3a03_A56 Crystal Structure Of Hox11l1 Homeodomain Length = 5 3e-08
3rkq_A58 Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Lengt 4e-08
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 4e-08
2hos_A63 Phage-selected Homeodomain Bound To Unmodified Dna 8e-08
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 2e-07
1ftt_A68 Thyroid Transcription Factor 1 Homeodomain (Rattus 5e-07
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 9e-07
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 1e-06
1zq3_P68 Nmr Solution Structure Of The Bicoid Homeodomain Bo 2e-06
2p81_A44 Engrailed Homeodomain Helix-Turn-Helix Motif Length 2e-06
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 3e-06
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 3e-06
2vi6_A62 Crystal Structure Of The Nanog Homeodomain Length = 4e-06
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 5e-06
1nk2_P77 VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES 6e-06
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 1e-05
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 2e-05
1qry_A80 Homeobox Protein Vnd (Ventral Nervous System Defect 2e-05
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 5e-05
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 5e-05
2kt0_A84 Solution Structure Of Human Stem Cell Transcription 1e-04
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 4e-04
2k40_A67 Nmr Structure Of Hesx-1 Homeodomain Double Mutant R 8e-04
>pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 Back     alignment and structure

Iteration: 1

Score = 118 bits (296), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 54/79 (68%), Positives = 63/79 (79%) Query: 191 LYPWMKSNHDASYSCKTGGGNKRSRQTYSRYQTLELEKEFHYNKYLSRKRRIEIAHELQL 250 +YPWMK H + + G KR R +Y+RYQTLELEKEFH+N+YL+R+RRIEIAH L L Sbjct: 8 IYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSL 67 Query: 251 TERQIKIWFQNRRMKLKKE 269 TERQIKIWFQNRRMK KKE Sbjct: 68 TERQIKIWFQNRRMKWKKE 86
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure
>pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 Back     alignment and structure
>pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 Back     alignment and structure
>pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 Back     alignment and structure
>pdb|1FTZ|A Chain A, Nuclear Magnetic Resonance Solution Structure Of The Fushi Tarazu Homeodomain From Drosophila And Comparison With The Antennapedia Homeodomain Length = 70 Back     alignment and structure
>pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 Back     alignment and structure
>pdb|2H1K|A Chain A, Crystal Structure Of The Pdx1 Homeodomain In Complex With Dna Length = 63 Back     alignment and structure
>pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 Back     alignment and structure
>pdb|2LP0|A Chain A, The Solution Structure Of Homeodomain-Protein Complex Length = 60 Back     alignment and structure
>pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure
>pdb|2DJN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Dlx-5 Length = 70 Back     alignment and structure
>pdb|2CRA|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeo Box B13 Length = 70 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|1JGG|A Chain A, Even-Skipped Homeodomain Complexed To At-Rich Dna Length = 60 Back     alignment and structure
>pdb|2L9R|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Homeobox Protein Nkx-3.1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6470a Length = 69 Back     alignment and structure
>pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 Back     alignment and structure
>pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 Back     alignment and structure
>pdb|2L7Z|A Chain A, Nmr Structure Of A13 Homedomain Length = 73 Back     alignment and structure
>pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 Back     alignment and structure
>pdb|2LD5|A Chain A, Solution Nmr-Derived Complex Structure Of Hoxa13 Dna Binding Domain Bound To Dna Length = 67 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure
>pdb|3A03|A Chain A, Crystal Structure Of Hox11l1 Homeodomain Length = 56 Back     alignment and structure
>pdb|3RKQ|A Chain A, Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Length = 58 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|1ZQ3|P Chain P, Nmr Solution Structure Of The Bicoid Homeodomain Bound To The Consensus Dna Binding Site Taatcc Length = 68 Back     alignment and structure
>pdb|2P81|A Chain A, Engrailed Homeodomain Helix-Turn-Helix Motif Length = 44 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|2VI6|A Chain A, Crystal Structure Of The Nanog Homeodomain Length = 62 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|1QRY|A Chain A, Homeobox Protein Vnd (Ventral Nervous System Defective Protein) Length = 80 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2KT0|A Chain A, Solution Structure Of Human Stem Cell Transcription Factor Nanog Homeodomain Fragment Length = 84 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2K40|A Chain A, Nmr Structure Of Hesx-1 Homeodomain Double Mutant R31lE42L Length = 67 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 2e-45
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 2e-43
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 6e-43
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 9e-40
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 3e-39
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 3e-38
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 3e-38
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 4e-38
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 1e-37
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 9e-37
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 1e-36
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 2e-36
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 7e-35
3a01_A93 Homeodomain-containing protein; homeodomain, prote 3e-34
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 3e-32
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 5e-31
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 5e-31
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 5e-30
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 1e-29
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 6e-28
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 1e-27
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 2e-27
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 3e-26
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 4e-26
1e3o_C160 Octamer-binding transcription factor 1; transcript 1e-21
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 4e-20
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 9e-19
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-18
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 9e-18
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-17
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 8e-17
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-15
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 8e-15
3d1n_I151 POU domain, class 6, transcription factor 1; prote 3e-14
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 5e-14
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 6e-14
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 7e-14
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 8e-14
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 1e-13
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 3e-13
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 3e-13
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 4e-13
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 6e-13
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 8e-13
1uhs_A72 HOP, homeodomain only protein; structural genomics 9e-13
3a02_A60 Homeobox protein aristaless; homeodomain, developm 3e-12
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 3e-12
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 3e-12
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 8e-12
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 3e-11
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 5e-11
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 2e-09
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 1e-07
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 2e-07
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 4e-07
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 2e-06
1lfb_A99 Liver transcription factor (LFB1); transcription r 9e-06
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 5e-05
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 4e-04
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
 Score =  148 bits (375), Expect = 2e-45
 Identities = 54/81 (66%), Positives = 63/81 (77%)

Query: 189 ATLYPWMKSNHDASYSCKTGGGNKRSRQTYSRYQTLELEKEFHYNKYLSRKRRIEIAHEL 248
             +YPWMK  H  + +    G  KR R +Y+RYQTLELEKEFH+N+YL+R+RRIEIAH L
Sbjct: 6   PQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL 65

Query: 249 QLTERQIKIWFQNRRMKLKKE 269
            LTERQIKIWFQNRRMK KKE
Sbjct: 66  SLTERQIKIWFQNRRMKWKKE 86


>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query321
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.84
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.79
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.79
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.79
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.79
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.79
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.79
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.78
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.78
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.78
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.78
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.78
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.78
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.77
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.77
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.77
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.77
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.77
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.77
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.76
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.76
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.76
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.76
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.76
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.76
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.76
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.76
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.76
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.75
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.75
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.75
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.75
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.75
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.74
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.74
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.74
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.74
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.73
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.73
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.73
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.73
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.73
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.73
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.73
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.72
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.72
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.72
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.72
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.71
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.69
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.69
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.69
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.69
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.69
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.68
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.68
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.67
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.67
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.67
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.66
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.66
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.66
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.65
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.65
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.64
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.64
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.64
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.64
2e19_A64 Transcription factor 8; homeobox domain, structura 99.63
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.61
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.58
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.52
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.44
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.37
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.33
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.32
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.26
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.64
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 92.83
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
Probab=99.84  E-value=2.3e-21  Score=152.22  Aligned_cols=84  Identities=64%  Similarity=1.082  Sum_probs=65.2

Q ss_pred             CCCCcCccccCCCCCCCCCCCCCCCCCCCcccChHHHHHHHHHhhhcccccHHHHHHHHHHcCCCchhhhhhhhhHHhHh
Q psy13592        187 DGATLYPWMKSNHDASYSCKTGGGNKRSRQTYSRYQTLELEKEFHYNKYLSRKRRIEIAHELQLTERQIKIWFQNRRMKL  266 (321)
Q Consensus       187 dg~~~~Pwm~~s~~~s~s~~~~~k~rR~RT~fT~~Ql~~LEk~F~~~~yPs~~~r~~LA~~l~Ls~~qVqvWFQNRRaK~  266 (321)
                      .....+|||...+.+.......++.+|.|+.||..|+.+||..|..++||+..+|++||..|||++++|+|||||||+|+
T Consensus         4 ~p~~~~pwm~~~~~~~~~~~~~~~~rr~Rt~ft~~Ql~~Le~~F~~~~yp~~~~r~~La~~l~l~~~qV~vWFqNRR~k~   83 (88)
T 2r5y_A            4 NPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKW   83 (88)
T ss_dssp             CCSSCCGGGSCC---------------CCCCCCHHHHHHHHHHHTTCSSCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHH
T ss_pred             CCCCCCchhhccCCCCCCCCCCCCCCCCCCCcCHHHHHHHHHHHhccCCCCHHHHHHHHHHhCcCHHHhhHHhHHHHHHh
Confidence            35678999998776555555566788999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhh
Q psy13592        267 KKEV  270 (321)
Q Consensus       267 Kr~~  270 (321)
                      ||..
T Consensus        84 kk~~   87 (88)
T 2r5y_A           84 KKEH   87 (88)
T ss_dssp             HTTC
T ss_pred             Hhhc
Confidence            9865



>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 321
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 5e-26
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 2e-25
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 3e-25
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-24
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-24
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-23
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 4e-22
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 6e-22
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-21
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 5e-21
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 6e-21
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 1e-20
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-20
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-20
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 4e-20
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 9e-20
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 2e-19
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 7e-19
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 2e-18
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 4e-18
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 4e-18
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 4e-18
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 6e-18
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 7e-18
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 1e-17
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 3e-17
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 7e-17
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 9e-16
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 1e-14
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 5e-14
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 1e-13
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 6e-13
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Paired box protein pax6
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 96.0 bits (239), Expect = 5e-26
 Identities = 21/58 (36%), Positives = 35/58 (60%)

Query: 212 KRSRQTYSRYQTLELEKEFHYNKYLSRKRRIEIAHELQLTERQIKIWFQNRRMKLKKE 269
           +R+R ++++ Q   LEKEF    Y     R  +A ++ L E +I++WF NRR K ++E
Sbjct: 2   QRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRRE 59


>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query321
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.82
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.81
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.8
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.8
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.8
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.8
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.8
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.79
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.79
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.78
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.78
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.78
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.77
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.76
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.76
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.74
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.73
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.73
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.72
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.71
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.71
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.7
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.68
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.67
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.66
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.63
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.6
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.58
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.56
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.51
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.46
d1k78a261 Pax-5 {Human (Homo sapiens) [TaxId: 9606]} 99.13
d6paxa265 Pax-6 {Human (Homo sapiens) [TaxId: 9606]} 99.06
d1pdnc_123 Paired protein (prd) {Fruit fly (Drosophila melano 96.95
d1hlva166 DNA-binding domain of centromere binding protein B 82.26
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.82  E-value=5.7e-21  Score=148.69  Aligned_cols=81  Identities=51%  Similarity=0.771  Sum_probs=61.4

Q ss_pred             cCccccCCCCCCC----CCCCCCCCCCCCcccChHHHHHHHHHhhhcccccHHHHHHHHHHcCCCchhhhhhhhhHHhHh
Q psy13592        191 LYPWMKSNHDASY----SCKTGGGNKRSRQTYSRYQTLELEKEFHYNKYLSRKRRIEIAHELQLTERQIKIWFQNRRMKL  266 (321)
Q Consensus       191 ~~Pwm~~s~~~s~----s~~~~~k~rR~RT~fT~~Ql~~LEk~F~~~~yPs~~~r~~LA~~l~Ls~~qVqvWFQNRRaK~  266 (321)
                      .|+||........    +..+..+.+|.|+.||.+|+.+||..|..++||+..+|++||..|||++++|+|||||||+|+
T Consensus         3 ~y~wm~~~r~~p~~~~~~~~~~~~~kr~Rt~ft~~Ql~~Le~~F~~n~yPs~~~r~~LA~~l~l~~~~V~vWFqNrR~k~   82 (88)
T d1b72a_           3 TFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQ   82 (88)
T ss_dssp             CCGGGGC--------------------CCCCCCHHHHHHHHHHHTTCSSCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHH
T ss_pred             CCCCCcCCCCCCCCCCCCCCCCCCCCCCCcCCCHHHHHHHHHHHHhCCCCchHHHHHHHHHcCCCHHHeeeccHhHHHHH
Confidence            4788876554322    122334567889999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhc
Q psy13592        267 KKEVL  271 (321)
Q Consensus       267 Kr~~~  271 (321)
                      ||..+
T Consensus        83 Kk~~~   87 (88)
T d1b72a_          83 KKRER   87 (88)
T ss_dssp             HHHHT
T ss_pred             HHhcc
Confidence            99754



>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k78a2 a.4.1.5 (A:82-142) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d6paxa2 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure