Diaphorina citri psyllid: psy13593


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MSHHHKHLTLVQGVPRSKRGEVWLFLAQQYCKQNPMDTSKFPNYNVSYEQLLKQLTSHQHAILLDLGRTFPSHPYYSSPLGPGQLSLFNVLKAYSLLDPEVGYCQGLSFVAGVLLLHHSEEQAFMMLRHLMFRRGLRQTYLPDMAALQVQLYQFSRLLLDHYPDLHAHFDTHEVHPTLYAAPWLLTLFSSQFPLGFVTRVFDMVLVENPEIVFRVMLSLLGQHRENLLRCENFETIMDYLKTNITVMDKRTVDAIVKQVHRKEL
cccHHHHHHHHccccccHHHHHHHHHHHcHHccccccccccccccHHHHHHHHccccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHcHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHccc
****HKH*TLVQGVPRSKRGEVWLFLAQQYCKQNPMDTSKFPNYNVSYEQLLKQLTSHQHAILLDLGRTFPSHPYYSSPLGPGQLSLFNVLKAYSLLDPEVGYCQGLSFVAGVLLLHHSEEQAFMMLRHLMFRRGLRQTYLPDMAALQVQLYQFSRLLLDHYPDLHAHFDTHEVHPTLYAAPWLLTLFSSQFPLGFVTRVFDMVLVENPEIVFRVMLSLLGQHRENLLRCENFETIMDYLKTNITVMDKRTVDAIVKQVHRKEL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHHHKHLTLVQGVPRSKRGEVWLFLAQQYCKQNPMDTSKFPNYNVSYEQLLKQLTSHQHAILLDLGRTFPSHPYYSSPLGPGQLSLFNVLKAYSLLDPEVGYCQGLSFVAGVLLLHHSEEQAFMMLRHLMFRRGLRQTYLPDMAALQVQLYQFSRLLLDHYPDLHAHFDTHEVHPTLYAAPWLLTLFSSQFPLGFVTRVFDMVLVENPEIVFRVMLSLLGQHRENLLRCENFETIMDYLKTNITVMDKRTVDAIVKQVHRKEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
TBC1 domain family member 1 May act as a GTPase-activating protein for Rab family protein(s). May play a role in the cell cycle and differentiation of various tissues. Involved in the trafficking and translocation of GLUT4-containing vesicles and insulin-stimulated glucose uptake into cells.confidentQ86TI0
TBC1 domain family member 1 May act as a GTPase-activating protein for Rab family protein(s). May play a role in the cell cycle and differentiation of various tissues. Involved in the trafficking and translocation of GLUT4-containing vesicles and insulin-stimulated glucose uptake into cells.confidentO97790

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032851 [BP]positive regulation of Rab GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0046578, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0043085, GO:0032318, GO:0043547, GO:0051345, GO:0032313, GO:0031323, GO:0030811, GO:0065007, GO:0044093, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0048583, GO:0050790, GO:0050794, GO:0032483, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:0051174, GO:1900542, GO:0009966, GO:0032320, GO:0031329, GO:0006140
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0032880 [BP]regulation of protein localizationprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0033627 [BP]cell adhesion mediated by integrinprobableGO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0005097 [MF]Rab GTPase activator activityprobableGO:0005099, GO:0030234, GO:0005096, GO:0030695, GO:0003674, GO:0008047, GO:0060589, GO:0005083
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0005178 [MF]integrin bindingprobableGO:0032403, GO:0005102, GO:0003674, GO:0005488, GO:0005515

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QYE, chain A
Confidence level:very confident
Coverage over the Query: 2-264
View the alignment between query and template
View the model in PyMOL