Diaphorina citri psyllid: psy13596


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MKGQQEHNGNSYRFIIISKFGSDLQKLLDEHKEFSLKNTLTITDFPILKVMSMEYCYQRNWQKQAVTSVIIGLEVRRKEALSAANDLTQALVDHLNVGVAQAYLNQKKLDAEAKQLHTNAITFSKQTQQWLSLVDNFNSALKEIGDVENWAKVIEEDMRLISAALETAYEGSINENTSAAAAKEDN
cccccccccccccEEEHHHHccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc
**********SYRFIIISKFGSDLQKLLDEHKEFSLKNTLTITDFPILKVMSMEYCYQRNWQKQAVTSVIIGLEVRRKEALSAANDLTQALVDHLNVGVAQAYLNQKKLDAEAKQLHTNAITFSKQTQQWLSLVDNFNSALKEIGDVENWAKVIEEDMRLISAALETAY*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGQQEHNGNSYRFIIISKFGSDLQKLLDEHKEFSLKNTLTITDFPILKVMSMEYCYQRNWQKQAVTSVIIGLEVRRKEALSAANDLTQALVDHLNVGVAQAYLNQKKLDAEAKQLHTNAITFSKQTQQWLSLVDNFNSALKEIGDVENWAKVIEEDMRLISAALETAYEGSINENTSAAAAKEDN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Biogenesis of lysosome-related organelles complex 1 subunit 1 May negatively regulate aerobic respiration through mitochondrial protein lysine-acetylation. May also be involved in the biogenesis of specialized organelles of the endosomal-lysosomal system.confidentQ0VFD8
Biogenesis of lysosome-related organelles complex 1 subunit 1 May negatively regulate aerobic respiration through mitochondrial protein lysine-acetylation. May counteract the action of the deacetylase SIRT3 by acetylating and regulating proteins of the mitochondrial respiratory chain including ATP5A1 AND NDUFA9. May also be involved in the biogenesis of specialized organelles of the endosomal-lysosomal system.confidentQ5R7L8
Biogenesis of lysosome-related organelles complex 1 subunit 1 May negatively regulate aerobic respiration through mitochondrial protein lysine-acetylation. May also be involved in the biogenesis of specialized organelles of the endosomal-lysosomal system. May also play a role in intracellular vesicle trafficking.confidentQ22616

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005759 [CC]mitochondrial matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0005758 [CC]mitochondrial intermembrane spaceprobableGO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0046907 [BP]intracellular transportprobableGO:0009987, GO:0006810, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0031083 [CC]BLOC-1 complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0031082
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LAV, chain A
Confidence level:probable
Coverage over the Query: 3-124
View the alignment between query and template
View the model in PyMOL