Diaphorina citri psyllid: psy13600


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MSTSDFRQRFDAVPTHSRRPPSTETVHCLDNIDSPLHLVDGTLIDGVDYVFQNQPLKITKLDVGDHTENDQTDAEKTVNEVMKDIVTNKTSILDEDTKSSLTPDEGNVRRMHTAVKLNEVIVNKSHEAQLVILNLPGPPKETNIERESNYMEFLEVLTEGLERVLMVRGSNSSHHCYRYLFCGSMA
ccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHHHcccccEEEEEcccccccccHHHHccccc
*************************VHCLDNIDSPLHLVDGTLIDGVDYVFQNQPLKITKLD**********************************************RRMHTAVKLNEVIVNKSHEAQLVILNLPGPPKETNIERESNYMEFLEVLTEGLERVLMVRGSNSSHHCYRYLFCGSMA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTSDFRQRFDAVPTHSRRPPSTETVHCLDNIDSPLHLVDGTLIDGVDYVFQNQPLKITKLDVGDHTENDQTDAEKTVNEVMKDIVTNKTSILDEDTKSSLTPDEGNVRRMHTAVKLNEVIVNKSHEAQLVILNLPGPPKETNIERESNYMEFLEVLTEGLERVLMVRGSNSSHHCYRYLFCGSMA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Solute carrier family 12 member 6 Mediates electroneutral potassium-chloride cotransport. May be activated by cell swelling. May contribute to cell volume homeostasis in single cells.confidentQ9UHW9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006813 [BP]potassium ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0071477 [BP]cellular hypotonic salinity responseprobableGO:0009628, GO:0051716, GO:0009987, GO:0042539, GO:0071472, GO:0050896, GO:0071470, GO:0044763, GO:0071476, GO:0008150, GO:0006950, GO:0006970, GO:0006971, GO:0033554, GO:0009651, GO:0071214, GO:0044699
GO:0015379 [MF]potassium:chloride symporter activityprobableGO:0022891, GO:0015294, GO:0015296, GO:0015291, GO:0015293, GO:0005215, GO:0008509, GO:0008324, GO:0015075, GO:0022857, GO:0022892, GO:0003674, GO:0015377, GO:0015103, GO:0015108, GO:0022804
GO:0015698 [BP]inorganic anion transportprobableGO:0006811, GO:0006810, GO:0006820, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted