Diaphorina citri psyllid: psy13612

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----

MPANHKIFNDSVHGHMKFHPICVAIIDTPQFQRLRNIKQTSTTYLVYPGACHNRFEHSLGVSYLGGCMVDALVHNTPGLHITAEEKLSVELAGLCHDLGHGPFSHTWEKFLRRFDSHWKHEQGSEEVLDYLIEDNKLGPLFESYNLNLNLIKELIRGGGESLPADKRFLYQIIANKETDIDVDKWDYFLRDGHQLNLKITFDYRRLLSFCTVVKRPTDSGPTIAFRNKEASNIFDMFRVRADLHLRAYQHCATKNTELVRRPSIDEVNLCCRGSVDGFNRSTAFDYVWRQLNSS

ccccccEECccccccccccHHHHHHcccHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHcccccccccccccHHHHHHHHHccccHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHHcEEEEcccccccEEEEccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcccc

***NHKIFNDSVHGHMKFHPICVAIIDTPQFQRLRNIKQTSTTYLVYPGACHNRFEHSLGVSYLGGCMVDALVHNTPGLHITAEEKLSVELAGLCHDLGHGPFSHTWEKFLRRFDSHWKHEQGSEEVLDYLIEDNKLGPLFESYNLNLNLIKELIRGGGESLPADKRFLYQIIANKETDIDVDKWDYFLRDGHQLNLKITFDYRRLLSFCTVVKRPTDSGPTIAFRNKEASNIFDMFRVRADLHLRAYQHCATKNTELVRRPSIDEVNLCCRGSVDGFNRSTAFDYVWRQLN**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
SAM domain and HD domain-containing protein 1	Putative nuclease involved in innate immune response by acting as a negative regulator of the cell-intrinsic antiviral response.	confident	Q5ZJL9

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045088 [BP]	regulation of innate immune response	probable	GO:0050776, GO:0080134, GO:0048583, GO:0008150, GO:0002682, GO:0065007, GO:0050789, GO:0031347
GO:0051607 [BP]	defense response to virus	probable	GO:0002376, GO:0009607, GO:0009615, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0002252, GO:0051707, GO:0051704
GO:0003723 [MF]	RNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U1N, chain A
Confidence level:very confident
Coverage over the Query: 8-271
View the alignment between query and template
View the model in PyMOL