Diaphorina citri psyllid: psy1361


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270----
QLVHHFVSEHRKWRVEELNVKEGKSTRARSACSSFCVGTQKMEGGRAKRQKIDKTNKFAAFQKLKDLKGQGVKHKYEFTADENVYEEVSEKEYTERVLKRQEDDWIDDDGGDGYVEDGREIFDDDIEDVPQKKEKHDKRKKNKNIQNPNAKGDIQKLLANMPVKKKKKEEVQLNNDDVLADLLSEVNTTIAPTLKLNTKTNEIVIPKEEPPAPTAKEYLANFSKPIKVEKKIEKPIKKEPSPLKDEIKSNDSVMEVEMNVAEQSKEEPVDDGLWEQMQIDDWDNSQQTQDVLPEQAKVELQIEAIESQSIEEKVDVTNVESVSSAVELSTSPPPQVVEKKEHKCAEWEAIQTEPSTSEPQVHSRTADDSLPLATDHENKKVFRMFFLDAFEDIYKQPGTVYLFGKVFVKENNSHSSCCVIVQNIDRKIYLLPRSEHLKTKEPVSIAQVYSEFDQIATQYKILDFKSRKIEKKYAFNLPGVPDLSEYLEVRYSAKCPALPSDLSGDTFSHVFGTKSSFLENLLLERKIKGPSWLEFPEAEKFPSRISWCKYEVQCNQMEKIRITNVCGNVLSRTLMGGRSERNEFLLLHAFHEKSYVLPDKQYGKNKKEGEETGEANKGKGRKKAAYSGGLVLEPKKGFYDKFIILMDFNSLYPSIIQEYNICFTTIPVRMLQDSDITTLCEYLPEHQVDTGILPSEIKKLVESRRQVKALMKQPNLSSDLLMQYDIRQKALKLTANSMYGCLGFPNSRFFAQPLAALVTAKGREILLNTKSLVENLNYEVIYGDTDSLMISCNVNDYDSVFKIGNQIKSECNKLYKQLELDIDGVYKYMLLLKKKKYAALSISKLSNGKMICSQEIKGVDVVRRDWSQLASEAGKFVISQILDEQSYTDYSLDDRLQNIHEHMKKIRTDLDNGFVPLTLLEITKQLTKAPEEYTDRKALPHVQVALRLNNTNSKKLKQGDTISYIICEDGTSEAATQRAYNIEELKNNSKLKIDVNYYLSQQIHPVVTRLLEPIEGTDAVRIAECLGLDTSLYRSQIKESIQQSEENILGVGEAEEVKYQFCDKFEFTCMNPSCKQVNTVEAPTRLSTHGVVFVLDECINPECKVPPYTYLPHLINKLSQDMNKYIVKYYEGWLKCEDPGCSDLTRRCPLGLKTRLCTTCHKYKLHRVYTELQLYQQLSFFHYICDITKALTKSDTPSIKFDSETYMGYCKMKQHVERFLESSAYNIVDLKKLFSCEEKQPKLSRGVEREHVTVAEGEGDDYEFDFDLEYSDLS
ccccHHHHHHcccccEEEccccccccccccccccEEcccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHcccccEEcccccccccccccccccccccccHHHHHHHccccccccccccccccHHHHHccccccccccHHcccccHHHHHHHHHcccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccccEEEEEEEEEEccccccEEEEEEEccccccEEEccccccccccccccHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccccEEEEECcccccccccccccccEEEEccccHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHcccccccEEEEEccHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccCEEEccccccccccEEEEEcccccHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccEEEEEcccccHHHHHHHHHHHHHHHHcccccEEEEEEcEEEcccccccccEEEEEEEEcccccEEEccEEccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccccccccHHHHHHHHHHccccccccccEEEEEEECccccccHHHccccHHHHHccccccccHHHHHHcccHHHHHHHccccccccHHHHHHHHccccccHHHHccHHHHccccccccccccHHHHHcccccEEEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHHccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEccccccccccccccccccccccEEEcccccccccccccccccccc
***********************************C*********************FAAFQKLKDLKGQGVKHKYEFTADENVYEEVSEKEYTERVLKRQEDDWIDDDGGDGYVEDGREIFD******************************************************VLADLLSEVNT*******************************************************************************************************************************************************************************************HENKKVFRMFFLDAFEDIYKQPGTVYLFGKVFVKENNSHSSCCVIVQNIDRKIYLLPRSEHLKTKEPVSIAQVYSEFDQIATQYKILDFKSRKIEKKYAFNLPGVPDLSEYLEVRYSAKCPALPSDLSGDTFSHVFGTKSSFLENLLLERKIKGPSWLEFPEAEKFPSRISWCKYEVQCNQMEKIRITNVCGNVLSRTLMGGRSERNEFLLLHAFHEKSYVLPDK*************************YSGGLVLEPKKGFYDKFIILMDFNSLYPSIIQEYNICFTTIPVRMLQDSDITTLCEYLPEHQVDTGILPSEIKKLVESRRQV********LSSDLLMQYDIRQKALKLTANSMYGCLGFPNSRFFAQPLAALVTAKGREILLNTKSLVENLNYEVIYGDTDSLMISCNVNDYDSVFKIGNQIKSECNKLYKQLELDIDGVYKYMLLLKKKKYAALSISKLSNGKMICSQEIKGVDVVRRDWSQLASEAGKFVISQILDEQSYTDYSLDDRLQNIHEHMKKIRTDLDNGFVPLTLLEITKQLTKAPEEYTDRKALPHVQVALRLNNTNSKKLKQGDTISYIICEDGTSEAATQRAYNIEELKNNSKLKIDVNYYLSQQIHPVVTRLLEPIEGTDAVRIAECLGLDTSLYRS************ILGVGEAEEVKYQFCDKFEFTCMNPSCKQVNTVEAPTRLSTHGVVFVLDECINPECKVPPYTYLPHLINKLSQDMNKYIVKYYEGWLKCEDPGCSDLTRRCPLGLKTRLCTTCHKYKLHRVYTELQLYQQLSFFHYICDITKALTKSDTPSIKFDSETYMGYCKMKQHVERFLESSAYNIVDLKKLFSC************************DYEFDFDLEYSDL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QLVHHFVSEHRKWRVEELNVKEGKSTRARSACSSFCVGTQKMEGGRAKRQKIDKTNKFAAFQKLKDLKGQGVKHKYEFTADENVYEEVSEKEYTERVLKRQEDDWIDDDGGDGYVEDGREIFDDDIEDVPQKKEKHDKRKKNKNIQNPNAKGDIQKLLANMPVKKKKKEEVQLNNDDVLADLLSEVNTTIAPTLKLNTKTNEIVIPKEEPPAPTAKEYLANFSKPIKVEKKIEKPIKKEPSPLKDEIKSNDSVMEVEMNVAEQSKEEPVDDGLWEQMQIDDWDNSQQTQDVLPEQAKVELQIEAIESQSIEEKVDVTNVESVSSAVELSTSPPPQVVEKKEHKCAEWEAIQTEPSTSEPQVHSRTADDSLPLATDHENKKVFRMFFLDAFEDIYKQPGTVYLFGKVFVKENNSHSSCCVIVQNIDRKIYLLPRSEHLKTKEPVSIAQVYSEFDQIATQYKILDFKSRKIEKKYAFNLPGVPDLSEYLEVRYSAKCPALPSDLSGDTFSHVFGTKSSFLENLLLERKIKGPSWLEFPEAEKFPSRISWCKYEVQCNQMEKIRITNVCGNVLSRTLMGGRSERNEFLLLHAFHEKSYVLPDKQYGKNKKEGEETGEANKGKGRKKAAYSGGLVLEPKKGFYDKFIILMDFNSLYPSIIQEYNICFTTIPVRMLQDSDITTLCEYLPEHQVDTGILPSEIKKLVESRRQVKALMKQPNLSSDLLMQYDIRQKALKLTANSMYGCLGFPNSRFFAQPLAALVTAKGREILLNTKSLVENLNYEVIYGDTDSLMISCNVNDYDSVFKIGNQIKSECNKLYKQLELDIDGVYKYMLLLKKKKYAALSISKLSNGKMICSQEIKGVDVVRRDWSQLASEAGKFVISQILDEQSYTDYSLDDRLQNIHEHMKKIRTDLDNGFVPLTLLEITKQLTKAPEEYTDRKALPHVQVALRLNNTNSKKLKQGDTISYIICEDGTSEAATQRAYNIEELKNNSKLKIDVNYYLSQQIHPVVTRLLEPIEGTDAVRIAECLGLDTSLYRSQIKESIQQSEENILGVGEAEEVKYQFCDKFEFTCMNPSCKQVNTVEAPTRLSTHGVVFVLDECINPECKVPPYTYLPHLINKLSQDMNKYIVKYYEGWLKCEDPGCSDLTRRCPLGLKTRLCTTCHKYKLHRVYTELQLYQQLSFFHYICDITKALTKSDTPSIKFDSETYMGYCKMKQHVERFLESSAYNIVDLKKLFSCEEKQPKLSRGVEREHVTVAEGEGDDYEFDFDLEYSDLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA polymerase alpha catalytic subunit Plays an essential role in the initiation of DNA replication. During the S phase of the cell cycle, the DNA polymerase alpha complex (composed of a catalytic subunit POLA1/p180, a regulatory subunit POLA2/p70 and two primase subunits PRIM1/p49 and PRIM2/p58) is recruited to DNA at the replicative forks via direct interactions with MCM10 and WDHD1. The primase subunit of the polymerase alpha complex initiates DNA synthesis by oligomerising short RNA primers on both leading and lagging strands. These primers are initially extended by the polymerase alpha catalytic subunit and subsequently transferred to polymerase delta and polymerase epsilon for processive synthesis on the lagging and leading strand, respectively. The reason this transfer occurs is because the polymerase alpha has limited processivity and lacks intrinsic 3' exonuclease activity for proofreading error, and therefore is not well suited for replicating long complexes.confidentP09884
DNA polymerase alpha catalytic subunit (Fragment) Plays an essential role in the initiation of DNA replication. During the S phase of the cell cycle, the DNA polymerase alpha complex (composed of a catalytic subunit POLA1/p180, a regulatory subunit POLA2/p70 and two primase subunits PRIM1/p49 and PRIM2/p58) is recruited to DNA at the replicative forks via direct interactions with MCM10 and WDHD1. The primase subunit of the polymerase alpha complex initiates DNA synthesis by oligomerising short RNA primers on both leading and lagging strands. These primers are initially extended by the polymerase alpha catalytic subunit and subsequently transferred to polymerase delta and polymerase epsilon for processive synthesis on the lagging and leading strand, respectively. The reason this transfer occurs is because the polymerase alpha has limited processivity and lacks intrinsic 3' exonuclease activity for proofreading error, and therefore is not well suited for replicating long complexes.confidentO89042
DNA polymerase alpha catalytic subunit Plays an essential role in the initiation of DNA replication. During the S phase of the cell cycle, the DNA polymerase alpha complex (composed of a catalytic subunit POLA1/p180, a regulatory subunit POLA2/p70 and two primase subunits PRIM1/p49 and PRIM2/p58) is recruited to DNA at the replicative forks via direct interactions with MCM10 and WDHD1. The primase subunit of the polymerase alpha complex initiates DNA synthesis by oligomerising short RNA primers on both leading and lagging strands. These primers are initially extended by the polymerase alpha catalytic subunit and subsequently transferred to polymerase delta and polymerase epsilon for processive synthesis on the lagging and leading strand, respectively. The reason this transfer occurs is because the polymerase alpha has limited processivity and lacks intrinsic 3' exonuclease activity for proofreading error, and therefore is not well suited for replicating long complexes.confidentP33609

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0006260 [BP]DNA replicationprobableGO:0071704, GO:1901576, GO:0044238, GO:0008152, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0044249, GO:0009058, GO:0009059, GO:0006807, GO:0034645, GO:0006259, GO:0008150, GO:1901360, GO:0046483
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0003674 [MF]molecular_functionprobable

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.7.-Nucleotidyltransferases.probable
2.7.7.7DNA-directed DNA polymerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S5J, chain A
Confidence level:very confident
Coverage over the Query: 560-610,629-911
View the alignment between query and template
View the model in PyMOL
Template: 3IAY, chain A
Confidence level:very confident
Coverage over the Query: 560-603,621-1017
View the alignment between query and template
View the model in PyMOL
Template: 3FLO, chain B
Confidence level:very confident
Coverage over the Query: 1055-1223
View the alignment between query and template
View the model in PyMOL
Template: 4B08, chain A
Confidence level:confident
Coverage over the Query: 550-600,631-1013
View the alignment between query and template
View the model in PyMOL