Diaphorina citri psyllid: psy13629

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-----

MALLHFQIPQYRPEISLDDRSFALYSATIMDIPSSVVYLYPHLIRPEISLDDRSFALYSATIMDIPSSVVYLYPHLISLHVIDPNSDEMPVQERCSFEKLQPDGAYLLDIRIANLSRPLKPVTIIKDLEEGAAIDYYYKKSMVCWTDHGTEMISCCTFDGNNVGSKHNVITNGLITPDGLAIDWLTEKLYWTDSETNKLEVSSLDGKKRKVLYWEDIDQPRAIALVPQDSIMFWTDWGEVPKIERGAMNGDPRHRKVIVDSTIFWPNGIAIDFNNRLLYWIDGRLTFIEVMDYDGYVRLVTSLGHINLELYCNVFPKTCENFMKHCENGYYNGTKFHRSIRNFMIQGGDPTGTGTGGESIWGKPFEDEFKPNYTHTGRGVLSMANSGPNTNTSQL

cccEEEEcccccccEECcccccEEEEEEECcccccEEEEccccccccccccccccccEEcccccccccCEEEcccccCEEEEcccccccccccccccccccccccccEEEEEECcccccccEEEccccccEEEEEEEccccEEEEEEcccccEEEECccccccccCEEEECcccccccEEEEEEccccEEEEEccccEEEEEEcccccCEEEECccccccEEEEEEcccccEEEEccccccEEEEECcccccccEEEEEEcccccccCEEEEccccEEEEEEccccEEEEEcccccEEEEEEEccccEEEEEEEEcccccccEEEEEccCCccCEEEEcccccEEEcccccccccccccccccccccccccccccccccEEEEcccccccccccc

***LHFQIPQYRPEISLDDRSFALYSATIMDIPSSVVYLYPHLIRPEISLDDRSFALYSATIMDIPSSVVYLYPHLISLHVIDPNSDEMPVQERCSFEKLQPDGAYLLDIRIANLSRPLKPVTIIKDLEEGAAIDYYYKKSMVCWTDHGTEMISCCTFDGNNVGSKHNVITNGLITPDGLAIDWLTEKLYWTDSETNKLEVSSLDGKKRKVLYWEDIDQPRAIALVPQDSIMFWTDWGEVPKIERGAMNGDPRHRKVIVDSTIFWPNGIAIDFNNRLLYWIDGRLTFIEVMDYDGYVRLVTSLGHINLELYCNVFPKTCENFMKHCENGYYNGTKFHRSIRNFMIQGGDPTGTGTGGESIWGKPFEDEFKPNYTHTGRGVLSMAN**********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Peptidyl-prolyl cis-trans isomerase-like 3	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.	confident	P0CP86
Peptidyl-prolyl cis-trans isomerase-like 1	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.	confident	P0CP84

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0045859 [BP]	regulation of protein kinase activity	probable	GO:0042325, GO:0032268, GO:0019220, GO:0019222, GO:0050790, GO:0060255, GO:0051246, GO:0043549, GO:0031323, GO:0051338, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0065009, GO:0001932, GO:0050789, GO:0080090
GO:0008284 [BP]	positive regulation of cell proliferation	probable	GO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0007165 [BP]	signal transduction	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005901 [CC]	caveola	probable	GO:0045121, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0051049 [BP]	regulation of transport	probable	GO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0071013 [CC]	catalytic step 2 spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0007275 [BP]	multicellular organismal development	probable	GO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0005041 [MF]	low-density lipoprotein receptor activity	probable	GO:0038024, GO:0003674, GO:0030228, GO:0004872
GO:0033043 [BP]	regulation of organelle organization	probable	GO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051128
GO:0000413 [BP]	protein peptidyl-prolyl isomerization	probable	GO:0044267, GO:0018208, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152
GO:0006810 [BP]	transport	probable	GO:0051234, GO:0008150, GO:0051179
GO:0071813 [MF]	lipoprotein particle binding	probable	GO:0003674, GO:0071814, GO:0005488
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0038023 [MF]	signaling receptor activity	probable	GO:0060089, GO:0003674, GO:0004872, GO:0004871
GO:0030229 [MF]	very-low-density lipoprotein particle receptor activity	probable	GO:0038024, GO:0003674, GO:0030228, GO:0004872
GO:0045177 [CC]	apical part of cell	probable	GO:0005575, GO:0044464, GO:0005623
GO:0044767 [BP]	single-organism developmental process	probable	GO:0032502, GO:0008150, GO:0044699
GO:0016023 [CC]	cytoplasmic membrane-bounded vesicle	probable	GO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0044093 [BP]	positive regulation of molecular function	probable	GO:0008150, GO:0065009, GO:0065007
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0030111 [BP]	regulation of Wnt receptor signaling pathway	probable	GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0045893 [BP]	positive regulation of transcription, DNA-dependent	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0005769 [CC]	early endosome	probable	GO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0009653 [BP]	anatomical structure morphogenesis	probable	GO:0032502, GO:0048856, GO:0008150

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S94, chain A
Confidence level:very confident
Coverage over the Query: 108-311,332-351
View the alignment between query and template
View the model in PyMOL

Template: 3S94, chain A
Confidence level:very confident
Coverage over the Query: 80-311,332-351
View the alignment between query and template
View the model in PyMOL

Template: 1ZKC, chain A
Confidence level:very confident
Coverage over the Query: 296-395
View the alignment between query and template
View the model in PyMOL

Template: 3EFO, chain B
Confidence level:confident
Coverage over the Query: 44-108
View the alignment between query and template
View the model in PyMOL

Template: 2NUT, chain A
Confidence level:probable
Coverage over the Query: 10-109
View the alignment between query and template
View the model in PyMOL