Diaphorina citri psyllid: psy13645


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MKERLREGDHQFYHKWALLTDPDDIAGGPKGYLKCDISVIGKGDTVKIPQKSEKDEDDIEANLLLPEGVPLERQHARFIIRIYRADGLPKMNSSLVANVKKAFTGETKDLVDPYVQVSFAGLTGKTSVKKNSYNPVWNEQIIFSEMFPPLCSRIKIQLRDNDPVNNTVIGTHYIDLKNISNDGDKGKDYTY
cccccccccccHHHHHHcccccccccccccEEEEEEEEEEccccccccccccccccHHHHHccccccccccccEEEEEEEEEEECcccccccHHHHHHHHHccccccccccccEEEEEEccccccEEEEccccccccccEEEEEEEccccccEEEEEEEEccccccCEEEEEEEEcccccccccccccccc
****LREGDHQFYHKWALLTDPDDIAGGPKGYLKCDISVIGKGDTV**************ANLLLPEGVPLERQHARFIIRIYRADGLPKMNSSLVANVKKAFTGETKDLVDPYVQVSFAGLTGKTSVKKNSYNPVWNEQIIFSEMFPPLCSRIKIQLRDNDPVNNTVIGTHYIDLKNISNDGD*GK***Y
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKERLREGDHQFYHKWALLTDPDDIAGGPKGYLKCDISVIGKGDTVKIPQKSEKDEDDIEANLLLPEGVPLERQHARFIIRIYRADGLPKMNSSLVANVKKAFTGETKDLVDPYVQVSFAGLTGKTSVKKNSYNPVWNEQIIFSEMFPPLCSRIKIQLRDNDPVNNTVIGTHYIDLKNISNDGDKGKDYTY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Otoferlin Key calcium ion sensor involved in the Ca(2+)-triggered synaptic vesicle-plasma membrane fusion and in the control of neurotransmitter release at these output synapses.confidentQ5SPC5
Otoferlin Key calcium ion sensor involved in the Ca(2+)-triggered synaptic vesicle-plasma membrane fusion and in the control of neurotransmitter release at these output synapses. Interacts in a calcium-dependent manner to the presynaptic SNARE proteins at ribbon synapses of cochlear inner hair cells (IHCs) to trigger exocytosis of neurotransmitter. Also essential to synaptic exocytosis in immature outer hair cells (OHCs). May also play a role within the recycling of endosomes.confidentQ9HC10
Otoferlin Key calcium ion sensor involved in the Ca(2+)-triggered synaptic vesicle-plasma membrane fusion and in the control of neurotransmitter release at these output synapses. Interacts in a calcium-dependent manner to the presynaptic SNARE proteins at ribbon synapses of cochlear inner hair cells (IHCs) to trigger exocytosis of neurotransmitter. Also essential to synaptic exocytosis in immature outer hair cells (OHCs). May also play a role within the recycling of endosomes.confidentQ9ERC5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030672 [CC]synaptic vesicle membraneprobableGO:0008021, GO:0043229, GO:0045202, GO:0030135, GO:0043226, GO:0030136, GO:0030665, GO:0005575, GO:0031090, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044456, GO:0005737, GO:0030659, GO:0012505, GO:0012506, GO:0031982, GO:0043227, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R83, chain A
Confidence level:very confident
Coverage over the Query: 75-93,108-188
View the alignment between query and template
View the model in PyMOL
Template: 3QR0, chain A
Confidence level:very confident
Coverage over the Query: 26-52,65-91,110-183
View the alignment between query and template
View the model in PyMOL