Psyllid ID: psy13645


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MKERLREGDHQFYHKWALLTDPDDIAGGPKGYLKCDISVIGKGDTVKIPQKSEKDEDDIEANLLLPEGVPLERQHARFIIRIYRADGLPKMNSSLVANVKKAFTGETKDLVDPYVQVSFAGLTGKTSVKKNSYNPVWNEQIIFSEMFPPLCSRIKIQLRDNDPVNNTVIGTHYIDLKNISNDGDKGKDYTY
ccccccccccHHHHHHHcccccccccccccEEEEEEEEEEccccccccccccccccHHHHHccccccccccccEEEEEEEEEEEEcccccccHHHHHHHHHccccccccccccEEEEEEccccccEEEEccccccccccEEEEEEEccccccEEEEEEEEccccccEEEEEEEEEcccccccccccccccc
cccEcccccccHHHEEEEccccccccccccEEEEEEEEEEEccccccccccccccHHHHHHHcccccccccccccEEEEEEEEEccccccccHHHHHHHHHHHccccccccccEEEEEEccccccEEEEEccccccHcHEEEEHHHcccHccEEEEEEEEcccccccEEEEEEEEHHHHcccccccccccc
mkerlregdhqfyhkwalltdpddiaggpkgylkcdisvigkgdtvkipqksekdeddieanlllpegvpleRQHARFIIRIYRadglpkmnsSLVANVKKaftgetkdlvdpyvqvsfagltgktsvkknsynpvwneqiifsemfpplcsrikiqlrdndpvnntvIGTHYIdlknisndgdkgkdyty
MKERLREGDHQFYHKWALLTDPDDIAGGPKGYLKCDIsvigkgdtvkipqksekdeddiEANLllpegvplerQHARFIIRIYRadglpkmnsSLVANVKKAFtgetkdlvdpYVQVSfagltgktsvkknsynpVWNEQIIFSEMFPPLCSRIKIQLRDNDPVNNTVIGthyidlknisndgdkgkdyty
MKERLREGDHQFYHKWALLTDPDDIAGGPKGYLKCDISVIGKGDTVKIPQKSEKDEDDIEANLLLPEGVPLERQHARFIIRIYRADGLPKMNSSLVANVKKAFTGETKDLVDPYVQVSFAGLTGKTSVKKNSYNPVWNEQIIFSEMFPPLCSRIKIQLRDNDPVNNTVIGTHYIDLKNISNDGDKGKDYTY
*********HQFYHKWALLTDPDDIAGGPKGYLKCDISVIGKGDTV**************ANLLLPEGVPLERQHARFIIRIYRADGLPKMNSSLVANVKKAFTGETKDLVDPYVQVSFAGLTGKTSVKKNSYNPVWNEQIIFSEMFPPLCSRIKIQLRDNDPVNNTVIGTHYIDLKNI************
****LREGDHQFYHKWALLTDPDDIAGGPKGYLKCDISVIGKGD*****************NLLLPEGVPLERQHARFIIRIYRADGLPKMNS**********TGETKDLVDPYVQVSFAGLTGKTSVKKNSYNPVWNEQIIFSEMFPPLCSRIKIQLRDNDPVNNTVIGTHYIDLKNISNDGD*GK***Y
********DHQFYHKWALLTDPDDIAGGPKGYLKCDISVIGKGDTVKIPQKSEKDEDDIEANLLLPEGVPLERQHARFIIRIYRADGLPKMNSSLVANVKKAFTGETKDLVDPYVQVSFAGLTGKTSVKKNSYNPVWNEQIIFSEMFPPLCSRIKIQLRDNDPVNNTVIGTHYIDLKNISNDGDKGKDYTY
**ERLREGDHQFYHKWALLTDPDDIAGGPKGYLKCDISVIGKGDTVKIPQKSEKDEDDIEANLLLPEGVPLERQHARFIIRIYRADGLPKMNSSLVANVKKAFTGETKDLVDPYVQVSFAGLTGKTSVKKNSYNPVWNEQIIFSEMFPPLCSRIKIQLRDNDPVNNTVIGTHYIDLKNIS***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKERLREGDHQFYHKWALLTDPDDIAGGPKGYLKCDISVIGKGDTVKIPQKSEKDEDDIEANLLLPEGVPLERQHARFIIRIYRADGLPKMNSSLVANVKKAFTGETKDLVDPYVQVSFAGLTGKTSVKKNSYNPVWNEQIIFSEMFPPLCSRIKIQLRDNDPVNNTVIGTHYIDLKNISNDGDKGKDYTY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query191 2.2.26 [Sep-21-2011]
Q5SPC5 1992 Otoferlin OS=Danio rerio yes N/A 0.931 0.089 0.709 5e-76
Q9ERC5 1993 Otoferlin OS=Rattus norve yes N/A 0.931 0.089 0.698 1e-75
Q9ESF1 1997 Otoferlin OS=Mus musculus yes N/A 0.931 0.089 0.698 2e-75
Q9HC10 1997 Otoferlin OS=Homo sapiens yes N/A 0.931 0.089 0.698 2e-75
Q2WGJ9 1857 Fer-1-like protein 6 OS=H no N/A 0.926 0.095 0.636 2e-64
A3KGK3 1992 Fer-1-like protein 4 OS=M no N/A 0.931 0.089 0.444 2e-38
A9Z1Z3 1794 Fer-1-like protein 4 OS=H no N/A 0.931 0.099 0.433 2e-37
O75923 2080 Dysferlin OS=Homo sapiens no N/A 0.921 0.084 0.401 4e-35
A6QQP7 2107 Dysferlin OS=Bos taurus G no N/A 0.921 0.083 0.390 2e-34
Q9ESD7 2090 Dysferlin OS=Mus musculus no N/A 0.921 0.084 0.395 3e-34
>sp|Q5SPC5|OTOF_DANRE Otoferlin OS=Danio rerio GN=otof PE=3 SV=1 Back     alignment and function desciption
 Score =  283 bits (724), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 127/179 (70%), Positives = 155/179 (86%), Gaps = 1/179 (0%)

Query: 9   DHQFYHKWALLTDPDDIAGGPKGYLKCDISVIGKGDTVKIPQK-SEKDEDDIEANLLLPE 67
           +HQF+HKWA+L+DPDDI  G KGY+KCDI+V+GKGD +K P K SE DEDDIE NLLLPE
Sbjct: 354 EHQFHHKWAMLSDPDDITTGCKGYVKCDIAVVGKGDNIKTPHKASEADEDDIEGNLLLPE 413

Query: 68  GVPLERQHARFIIRIYRADGLPKMNSSLVANVKKAFTGETKDLVDPYVQVSFAGLTGKTS 127
           GVP ERQ ARF ++IYRA+GLPKMN+S++ANVKKAF GE +DLVDPYV V FAG  GKTS
Sbjct: 414 GVPSERQWARFYVKIYRAEGLPKMNTSIMANVKKAFIGENRDLVDPYVLVQFAGQKGKTS 473

Query: 128 VKKNSYNPVWNEQIIFSEMFPPLCSRIKIQLRDNDPVNNTVIGTHYIDLKNISNDGDKG 186
           V+K+SY P+WNEQ+IF+EMFPPLC R+K+Q+RD+D VN+  IGTH+IDL+ +SNDGDKG
Sbjct: 474 VQKSSYEPIWNEQVIFTEMFPPLCRRLKVQIRDSDKVNDVAIGTHFIDLRKVSNDGDKG 532




Key calcium ion sensor involved in the Ca(2+)-triggered synaptic vesicle-plasma membrane fusion and in the control of neurotransmitter release at these output synapses.
Danio rerio (taxid: 7955)
>sp|Q9ERC5|OTOF_RAT Otoferlin OS=Rattus norvegicus GN=Otof PE=1 SV=2 Back     alignment and function description
>sp|Q9ESF1|OTOF_MOUSE Otoferlin OS=Mus musculus GN=Otof PE=1 SV=1 Back     alignment and function description
>sp|Q9HC10|OTOF_HUMAN Otoferlin OS=Homo sapiens GN=OTOF PE=1 SV=3 Back     alignment and function description
>sp|Q2WGJ9|FR1L6_HUMAN Fer-1-like protein 6 OS=Homo sapiens GN=FER1L6 PE=2 SV=2 Back     alignment and function description
>sp|A3KGK3|FR1L4_MOUSE Fer-1-like protein 4 OS=Mus musculus GN=Fer1l4 PE=2 SV=3 Back     alignment and function description
>sp|A9Z1Z3|FR1L4_HUMAN Fer-1-like protein 4 OS=Homo sapiens GN=FER1L4 PE=2 SV=1 Back     alignment and function description
>sp|O75923|DYSF_HUMAN Dysferlin OS=Homo sapiens GN=DYSF PE=1 SV=1 Back     alignment and function description
>sp|A6QQP7|DYSF_BOVIN Dysferlin OS=Bos taurus GN=DYSF PE=2 SV=1 Back     alignment and function description
>sp|Q9ESD7|DYSF_MOUSE Dysferlin OS=Mus musculus GN=Dysf PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
270003272 2081 hypothetical protein TcasGA2_TC002482 [T 0.931 0.085 0.876 8e-90
91079903 2035 PREDICTED: similar to otoferlin [Triboli 0.931 0.087 0.876 1e-89
380017113 2060 PREDICTED: LOW QUALITY PROTEIN: otoferli 0.931 0.086 0.859 4e-89
383855487 2062 PREDICTED: otoferlin-like [Megachile rot 0.931 0.086 0.859 6e-89
307168069 1996 Otoferlin [Camponotus floridanus] 0.931 0.089 0.853 9e-89
328791519 2060 PREDICTED: otoferlin-like [Apis mellifer 0.931 0.086 0.853 1e-88
242020062 2007 conserved hypothetical protein [Pediculu 0.931 0.088 0.842 2e-88
340729191 2060 PREDICTED: LOW QUALITY PROTEIN: otoferli 0.931 0.086 0.853 2e-88
350416842 2060 PREDICTED: otoferlin-like [Bombus impati 0.931 0.086 0.853 2e-88
307204819 2061 Otoferlin [Harpegnathos saltator] 0.931 0.086 0.842 3e-88
>gi|270003272|gb|EEZ99719.1| hypothetical protein TcasGA2_TC002482 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  335 bits (858), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 156/178 (87%), Positives = 169/178 (94%)

Query: 9   DHQFYHKWALLTDPDDIAGGPKGYLKCDISVIGKGDTVKIPQKSEKDEDDIEANLLLPEG 68
           DHQFYHKWALLTDPDDIAGGPKGYLKCDISVIGKGDTVK+P KSEKDEDDIEANLLLP+G
Sbjct: 409 DHQFYHKWALLTDPDDIAGGPKGYLKCDISVIGKGDTVKVPPKSEKDEDDIEANLLLPDG 468

Query: 69  VPLERQHARFIIRIYRADGLPKMNSSLVANVKKAFTGETKDLVDPYVQVSFAGLTGKTSV 128
           VP++RQ ARFI++IYRADGLPKMNSSL+ANVKKAFTGE  DLVDPYVQVSFAGLTGKTSV
Sbjct: 469 VPIDRQRARFIVKIYRADGLPKMNSSLMANVKKAFTGELSDLVDPYVQVSFAGLTGKTSV 528

Query: 129 KKNSYNPVWNEQIIFSEMFPPLCSRIKIQLRDNDPVNNTVIGTHYIDLKNISNDGDKG 186
           KK+SY PVWNEQ++F+EMFPPLC RIKIQLRDNDPV  TVIGTH+IDLK ISNDG+KG
Sbjct: 529 KKHSYAPVWNEQLVFTEMFPPLCQRIKIQLRDNDPVKPTVIGTHFIDLKTISNDGEKG 586




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91079903|ref|XP_968595.1| PREDICTED: similar to otoferlin [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380017113|ref|XP_003692508.1| PREDICTED: LOW QUALITY PROTEIN: otoferlin-like [Apis florea] Back     alignment and taxonomy information
>gi|383855487|ref|XP_003703242.1| PREDICTED: otoferlin-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307168069|gb|EFN61375.1| Otoferlin [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328791519|ref|XP_003251587.1| PREDICTED: otoferlin-like [Apis mellifera] Back     alignment and taxonomy information
>gi|242020062|ref|XP_002430476.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212515622|gb|EEB17738.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340729191|ref|XP_003402890.1| PREDICTED: LOW QUALITY PROTEIN: otoferlin-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350416842|ref|XP_003491130.1| PREDICTED: otoferlin-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307204819|gb|EFN83377.1| Otoferlin [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
UNIPROTKB|E1BMQ1 1998 OTOF "Uncharacterized protein" 0.931 0.089 0.703 7e-70
UNIPROTKB|J9P9C0 1915 OTOF "Uncharacterized protein" 0.931 0.092 0.709 8.2e-70
UNIPROTKB|E2RDS5 1997 OTOF "Uncharacterized protein" 0.931 0.089 0.709 8.9e-70
ZFIN|ZDB-GENE-030131-7778 1992 otof "otoferlin" [Danio rerio 0.931 0.089 0.709 1.1e-69
RGD|620646 1993 Otof "otoferlin" [Rattus norve 0.931 0.089 0.698 2.4e-69
UNIPROTKB|Q9HC10 1997 OTOF "Otoferlin" [Homo sapiens 0.931 0.089 0.698 2.4e-69
MGI|MGI:1891247 1997 Otof "otoferlin" [Mus musculus 0.931 0.089 0.698 2.4e-69
UNIPROTKB|E1BS70 2010 OTOF "Uncharacterized protein" 0.931 0.088 0.715 3.1e-69
ZFIN|ZDB-GENE-110406-5 1801 si:ch73-50f9.1 "si:ch73-50f9.1 0.931 0.098 0.698 2.2e-68
RGD|1564703 1730 Fer1l6 "fer-1-like 6 (C. elega 0.926 0.102 0.648 1.9e-59
UNIPROTKB|E1BMQ1 OTOF "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 722 (259.2 bits), Expect = 7.0e-70, P = 7.0e-70
 Identities = 126/179 (70%), Positives = 158/179 (88%)

Query:     9 DHQFYHKWALLTDPDDIAGGPKGYLKCDISVIGKGDTVKIPQKS-EKDEDDIEANLLLPE 67
             +HQF+HKWA+L+DPDDI+ G KGY+KCD++V+GKGD +K P K+ E DEDDIE NLLLPE
Sbjct:   349 EHQFHHKWAVLSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPE 408

Query:    68 GVPLERQHARFIIRIYRADGLPKMNSSLVANVKKAFTGETKDLVDPYVQVSFAGLTGKTS 127
             GVP ERQ ARF ++IYRA+GLP+MN+SL+ANVKKAFTGE KDLVDPYVQV FAG  GKTS
Sbjct:   409 GVPPERQWARFYVKIYRAEGLPRMNTSLMANVKKAFTGENKDLVDPYVQVFFAGQKGKTS 468

Query:   128 VKKNSYNPVWNEQIIFSEMFPPLCSRIKIQLRDNDPVNNTVIGTHYIDLKNISNDGDKG 186
             V+K+SY P+WNEQ++F+++FPPLC R+K+Q+RD+D VN+  IGTH+IDL+ ISNDGDKG
Sbjct:   469 VQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDKG 527




GO:0016021 "integral to membrane" evidence=IEA
UNIPROTKB|J9P9C0 OTOF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDS5 OTOF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7778 otof "otoferlin" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|620646 Otof "otoferlin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9HC10 OTOF "Otoferlin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1891247 Otof "otoferlin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BS70 OTOF "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110406-5 si:ch73-50f9.1 "si:ch73-50f9.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1564703 Fer1l6 "fer-1-like 6 (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9HC10OTOF_HUMANNo assigned EC number0.69830.93190.0891yesN/A
Q9ERC5OTOF_RATNo assigned EC number0.69830.93190.0893yesN/A
Q9ESF1OTOF_MOUSENo assigned EC number0.69830.93190.0891yesN/A
Q5SPC5OTOF_DANRENo assigned EC number0.70940.93190.0893yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
cd04018151 cd04018, C2C_Ferlin, C2 domain third repeat in Fer 5e-66
pfam0815172 pfam08151, FerI, FerI (NUC094) domain 7e-27
cd00030102 cd00030, C2, C2 domain 8e-16
smart00239101 smart00239, C2, Protein kinase C conserved region 2e-15
pfam0016885 pfam00168, C2, C2 domain 1e-13
cd00275128 cd00275, C2_PLC_like, C2 domain present in Phospho 2e-11
COG5038 1227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 3e-09
cd04015158 cd04015, C2_plant_PLD, C2 domain present in plant 3e-08
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 4e-08
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 3e-07
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 4e-07
cd04017135 cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe 5e-07
cd08688110 cd08688, C2_KIAA0528-like, C2 domain found in the 9e-07
cd04039108 cd04039, C2_PSD, C2 domain present in Phosphatidyl 2e-06
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 5e-06
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 5e-06
cd08373127 cd08373, C2A_Ferlin, C2 domain first repeat in Fer 6e-06
cd08404136 cd08404, C2B_Synaptotagmin-4, C2 domain second rep 9e-06
cd04014132 cd04014, C2_PKC_epsilon, C2 domain in Protein Kina 1e-05
cd04041111 cd04041, C2A_fungal, C2 domain first repeat; funga 2e-05
cd04035123 cd04035, C2A_Rabphilin_Doc2, C2 domain first repea 3e-05
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 9e-05
cd08403134 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s 1e-04
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 2e-04
cd08386125 cd08386, C2A_Synaptotagmin-7, C2A domain first rep 2e-04
COG5038 1227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 3e-04
cd04021125 cd04021, C2_E3_ubiquitin_ligase, C2 domain present 3e-04
PLN03008 868 PLN03008, PLN03008, Phospholipase D delta 3e-04
cd08521123 cd08521, C2A_SLP, C2 domain first repeat present i 3e-04
cd04031125 cd04031, C2A_RIM1alpha, C2 domain first repeat con 5e-04
cd04030127 cd04030, C2C_KIAA1228, C2 domain third repeat pres 7e-04
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 8e-04
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 0.001
cd04045120 cd04045, C2C_Tricalbin-like, C2 domain third repea 0.001
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 0.001
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 0.001
cd04037124 cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer 0.001
cd08406136 cd08406, C2B_Synaptotagmin-12, C2 domain second re 0.001
cd04032127 cd04032, C2_Perforin, C2 domain of Perforin 0.002
cd08678126 cd08678, C2_C21orf25-like, C2 domain found in the 0.002
cd08378121 cd08378, C2B_MCTP_PRT_plant, C2 domain second repe 0.003
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 0.004
cd08681118 cd08681, C2_fungal_Inn1p-like, C2 domain found in 0.004
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 0.004
cd04046126 cd04046, C2_Calpain, C2 domain present in Calpain 0.004
>gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin Back     alignment and domain information
 Score =  199 bits (507), Expect = 5e-66
 Identities = 80/111 (72%), Positives = 93/111 (83%), Gaps = 1/111 (0%)

Query: 77  RFIIRIYRADGLPKMNSSLVANVKKAFTGETKDLVDPYVQVSFAGLTGKTSVKKNSYNPV 136
           RFI +IYRA+ LP+M+S ++ANVKKAF GE K+LVDPYV+VSFAG   KTSVKKNSYNP 
Sbjct: 1   RFIFKIYRAEDLPQMDSGIMANVKKAFLGEKKELVDPYVEVSFAGQKVKTSVKKNSYNPE 60

Query: 137 WNEQIIFSEMFPPLCSRIKIQLRDNDPV-NNTVIGTHYIDLKNISNDGDKG 186
           WNEQI+F EMFPPLC RIKIQ+RD D V N+ VIGTH+IDL  ISN GD+G
Sbjct: 61  WNEQIVFPEMFPPLCERIKIQIRDWDRVGNDDVIGTHFIDLSKISNSGDEG 111


Ferlins are involved in vesicle fusion events. Ferlins and other proteins, such as Synaptotagmins, are implicated in facilitating the fusion process when cell membranes fuse together. There are six known human Ferlins: Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3), Fer1L4, Fer1L5, and Fer1L6. Defects in these genes can lead to a wide range of diseases including muscular dystrophy (dysferlin), deafness (otoferlin), and infertility (fer-1, fertilization factor-1). Structurally they have 6 tandem C2 domains, designated as (C2A-C2F) and a single C-terminal transmembrane domain, though there is a new study that disputes this and claims that there are actually 7 tandem C2 domains with another C2 domain inserted between C2D and C2E. In a subset of them (Dysferlin, Myoferlin, and Fer1) there is an additional conserved domain called DysF. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. This cd contains the third C2 repeat, C2C, and has a type-II topology. Length = 151

>gnl|CDD|149289 pfam08151, FerI, FerI (NUC094) domain Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|175982 cd04015, C2_plant_PLD, C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>gnl|CDD|176004 cd04039, C2_PSD, C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>gnl|CDD|175981 cd04014, C2_PKC_epsilon, C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group Back     alignment and domain information
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|175988 cd04021, C2_E3_ubiquitin_ligase, C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>gnl|CDD|178585 PLN03008, PLN03008, Phospholipase D delta Back     alignment and domain information
>gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176051 cd08406, C2B_Synaptotagmin-12, C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>gnl|CDD|175998 cd04032, C2_Perforin, C2 domain of Perforin Back     alignment and domain information
>gnl|CDD|176060 cd08678, C2_C21orf25-like, C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
PF0815172 FerI: FerI (NUC094) domain; InterPro: IPR012968 Th 99.94
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.93
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.84
KOG1030|consensus168 99.83
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.82
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.82
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.82
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.82
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.82
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.81
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.81
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.8
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.8
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.8
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.79
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.79
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.79
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.79
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.78
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.78
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.78
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.78
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.78
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.78
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.78
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.77
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.77
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.77
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.76
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.76
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.76
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.76
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.76
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.76
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.76
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.76
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.75
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.75
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.75
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.75
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.75
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.74
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.74
KOG0696|consensus 683 99.74
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.74
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.74
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.74
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.74
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.73
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.73
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.73
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.73
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.73
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.72
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.72
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.72
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.72
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.72
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.71
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.71
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.71
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.71
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.71
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.71
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.71
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.71
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.7
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.69
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.69
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.69
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.69
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.68
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.68
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.68
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.68
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.67
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.67
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.66
PLN02223537 phosphoinositide phospholipase C 99.66
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.66
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.66
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.65
PLN03008 868 Phospholipase D delta 99.64
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.62
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.62
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.62
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.62
PLN02230598 phosphoinositide phospholipase C 4 99.6
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.6
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.6
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.6
KOG0169|consensus746 99.6
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.59
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.58
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.57
PLN02952599 phosphoinositide phospholipase C 99.57
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.56
PLN02222581 phosphoinositide phospholipase C 2 99.55
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.54
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.51
KOG1028|consensus 421 99.48
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.47
PLN02228567 Phosphoinositide phospholipase C 99.46
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.44
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.42
PLN02270 808 phospholipase D alpha 99.37
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.36
KOG1028|consensus421 99.34
KOG1264|consensus1267 99.33
KOG1011|consensus 1283 99.3
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 99.2
KOG1031|consensus 1169 99.16
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 99.04
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.99
KOG1328|consensus1103 98.9
KOG2059|consensus 800 98.87
KOG2059|consensus 800 98.73
KOG1265|consensus 1189 98.66
KOG1011|consensus1283 98.65
PLN02352 758 phospholipase D epsilon 98.54
KOG1326|consensus 1105 98.42
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 98.34
KOG1328|consensus 1103 98.28
KOG0905|consensus1639 98.23
KOG1013|consensus362 98.11
KOG1013|consensus 362 98.07
KOG1326|consensus 1105 98.02
PLN02964 644 phosphatidylserine decarboxylase 97.89
KOG2060|consensus405 97.62
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 97.38
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 96.83
cd08397159 C2_PI3K_class_III C2 domain present in class III p 96.77
KOG1327|consensus 529 96.77
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 96.53
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 96.36
KOG3837|consensus523 96.23
PF12416 340 DUF3668: Cep120 protein; InterPro: IPR022136 This 96.01
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 95.15
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 94.63
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 94.61
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 94.44
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 93.42
PF15625168 CC2D2AN-C2: CC2D2A N-terminal C2 domain 92.2
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 92.08
PF15627156 CEP76-C2: CEP76 C2 domain 91.92
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 91.25
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 89.84
cd08696179 C2_Dock-C C2 domains found in Dedicator Of CytoKin 89.26
cd08679178 C2_DOCK180_related C2 domains found in Dedicator O 88.47
cd08697185 C2_Dock-D C2 domains found in Dedicator Of CytoKin 87.39
KOG1327|consensus 529 83.94
>PF08151 FerI: FerI (NUC094) domain; InterPro: IPR012968 The ferlin gene family are characterised by multiple tandem C2 domains and a C-terminal transmembrane domain Back     alignment and domain information
Probab=99.94  E-value=1.3e-27  Score=151.13  Aligned_cols=69  Identities=61%  Similarity=1.029  Sum_probs=65.0

Q ss_pred             CccccccCCceeeehhccccCCCCCCCCccEEEEeEEEEEcCCCCCCCCCCC-CCCchhhhcccccCCCC
Q psy13645          1 MKERLREGDHQFYHKWALLTDPDDIAGGPKGYLKCDISVIGKGDTVKIPQKS-EKDEDDIEANLLLPEGV   69 (191)
Q Consensus         1 l~~iy~~~~h~~~~~W~~L~~p~~~~~~~~G~lk~s~~v~~~gd~~~~~~~~-~~~~~~i~~~~l~~~~~   69 (191)
                      |++||+||+|+|+|||+.|++|+|.++|++|||||+|+|+|+||++++.... .++++|||+|+|+|.|+
T Consensus         3 lgtVY~qP~H~~~~KW~~L~dP~D~~~G~kGYlKv~i~Vlg~GD~~~~~~~~~~~~~ddiE~NLL~P~G~   72 (72)
T PF08151_consen    3 LGTVYNQPDHQFYRKWALLTDPDDTSAGVKGYLKVDISVLGPGDEPPVEKKPTDEDEDDIEKNLLLPAGV   72 (72)
T ss_pred             eeeeecCCCCeeEeceEEecCCCCCccCCceEEEEEEEEEcCCCcCCCCCCCcccccchhhHhcCCCCCC
Confidence            5799999999999999999999999999999999999999999999998876 67789999999999885



They are found in a wide range of species and their function remains unknown, however, mutations in its two most well-characterised members, dysferlin and otoferlin, have been implicated in human disease []. This domain is present in proteins of the Ferlin family, which includes Otoferlin, Myoferlin and Dysferlin. It is often located between two C2 domains [].

>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>KOG1030|consensus Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>KOG1028|consensus Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>KOG1028|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG1011|consensus Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1031|consensus Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>KOG1328|consensus Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>KOG1265|consensus Back     alignment and domain information
>KOG1011|consensus Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG1326|consensus Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>KOG1328|consensus Back     alignment and domain information
>KOG0905|consensus Back     alignment and domain information
>KOG1013|consensus Back     alignment and domain information
>KOG1013|consensus Back     alignment and domain information
>KOG1326|consensus Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG2060|consensus Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1327|consensus Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG3837|consensus Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information
>cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins Back     alignment and domain information
>cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>KOG1327|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 1e-13
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 4e-12
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 4e-12
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 9e-12
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 6e-11
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 6e-10
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 9e-10
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 9e-10
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 1e-09
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 2e-09
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 4e-09
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 9e-09
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 3e-08
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 8e-08
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 6e-08
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 6e-08
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 6e-08
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 4e-07
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 8e-08
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 8e-08
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 1e-07
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 1e-07
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 1e-07
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 2e-07
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 2e-07
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 2e-07
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 2e-07
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 2e-07
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 2e-07
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 3e-07
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 3e-07
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 3e-07
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 4e-07
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 4e-07
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 8e-07
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 8e-07
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 1e-06
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 1e-06
3nsj_A540 Perforin-1; pore forming protein, immune system; H 2e-06
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 2e-06
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 3e-06
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 1e-05
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 2e-04
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 3e-04
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 4e-04
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 7e-04
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
 Score = 64.0 bits (156), Expect = 1e-13
 Identities = 31/114 (27%), Positives = 46/114 (40%), Gaps = 18/114 (15%)

Query: 80  IRIYRADGLPKMNSSLVANVKKAFTGETKDLVDPYVQVSFAGLTGKTSVKKNSYNPVWNE 139
           + +  A  +PK                     DP V V F     KT    N  NPVWNE
Sbjct: 11  VIVESASNIPKTKF---------------GKPDPIVSVIFKDEKKKTKKVDNELNPVWNE 55

Query: 140 QIIFSEMFPPL--CSRIKIQLRDNDPVN-NTVIGTHYIDLKNISNDGDKGKDYT 190
            + F     PL   S + I ++D + +  N +IGT  + LK+++ D  +   Y 
Sbjct: 56  ILEFDLRGIPLDFSSSLGIIVKDFETIGQNKLIGTATVALKDLTGDQSRSLPYK 109


>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Length = 799 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Length = 816 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.81
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.8
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.8
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.8
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.8
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.8
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.79
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.79
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.78
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.78
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.78
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.77
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.77
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.77
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.77
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.77
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.77
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.77
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.76
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.76
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.75
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.75
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.75
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.74
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.74
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.74
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.73
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.73
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.73
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.73
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.73
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.72
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.72
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.72
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.7
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.68
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.67
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.67
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.66
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.62
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.62
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.61
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.58
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.57
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.55
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.52
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.48
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.48
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 99.36
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 98.53
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 98.46
2wxf_A 940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 93.55
3l4c_A220 Dedicator of cytokinesis protein 1; DOCK180, DOCK1 91.62
3hhm_A 1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 90.74
1e7u_A 961 Phosphatidylinositol 3-kinase catalytic subunit; p 86.42
2y3a_A 1092 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 85.1
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} Back     alignment and structure
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Back     alignment and structure
>2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 2e-12
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 2e-09
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 4e-09
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 1e-08
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 3e-08
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 4e-08
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 4e-07
d2zkmx2122 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human 7e-07
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 1e-06
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 9e-06
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 4e-05
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 2e-04
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 3e-04
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 4e-04
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 0.001
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 0.003
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 0.003
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 0.004
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Unc-13 homolog A
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 59.4 bits (143), Expect = 2e-12
 Identities = 20/97 (20%), Positives = 41/97 (42%), Gaps = 3/97 (3%)

Query: 95  LVANVKKAFTGETKDLVDPYVQVSFAGLTGKTSVKKNSYNPVWNEQIIFSEMFPPLCSRI 154
           L   VKKA     ++  + YV +    +   T   + S  P W +  +F      L   +
Sbjct: 4   LCVGVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGS-QPSWEQDFMF--EINRLDLGL 60

Query: 155 KIQLRDNDPVNNTVIGTHYIDLKNISNDGDKGKDYTY 191
            +++ +   + +T++GT +I L+ I    ++G     
Sbjct: 61  TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWL 97


>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.84
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.82
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.78
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.78
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.77
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.76
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.75
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.75
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.75
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.73
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.73
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.72
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.72
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.69
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.67
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.67
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.64
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.61
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.6
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.41
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 95.66
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: C2 domain from protein kinase c (beta)
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.84  E-value=3.4e-21  Score=135.33  Aligned_cols=102  Identities=25%  Similarity=0.372  Sum_probs=87.7

Q ss_pred             ceEEEEEEEEecCCCCCChHHHHhhhhhhcCCCCCccCcEEEEEEC-----CeeeeeeeecCCCCCccccEEEEEeeCCC
Q psy13645         75 HARFIIRIYRADGLPKMNSSLVANVKKAFTGETKDLVDPYVQVSFA-----GLTGKTSVKKNSYNPVWNEQIIFSEMFPP  149 (191)
Q Consensus        75 ~~~L~v~i~~a~~L~~~~~~~~~~~~~~~~~~~~~~~dpyv~v~~~-----~~~~kT~~~~~~~nP~wne~~~f~~~~p~  149 (191)
                      ...|.|.|.+|++|+.++.              .+.+||||++.+.     ..+.+|++++++.||.|||.|.|.+..+.
T Consensus        14 ~~~L~V~V~~a~~L~~~d~--------------~g~~DpYv~v~l~~~~~~~~~~kT~v~~~t~nP~wne~f~f~v~~~~   79 (132)
T d1a25a_          14 REVLIVVVRDAKNLVPMDP--------------NGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESD   79 (132)
T ss_dssp             SSEEEEEEEEEESCCCCST--------------TSCCCEEEEEEEESCTTCSSCEECCCCSSCSSCEEEEEEEEECCSGG
T ss_pred             CCEEEEEEEeeeCCCCCCC--------------CCCcCeEEEEEEccCCCCccccEEeeecCCCCCccceEEEEEeEccc
Confidence            4689999999999998885              4678999999983     34789999999999999999999986555


Q ss_pred             CCceEEEEEEECCCCC-CceEEEEEeeccccccCCCCCcccc
Q psy13645        150 LCSRIKIQLRDNDPVN-NTVIGTHYIDLKNISNDGDKGKDYT  190 (191)
Q Consensus       150 ~~~~l~i~v~d~d~~~-d~~iG~~~l~l~~i~~~~~~g~~p~  190 (191)
                      ....|.|+|||+|..+ +++||.+.++|+++..++.++|++.
T Consensus        80 ~~~~L~i~V~d~d~~~~d~~iG~~~i~l~~l~~~~~~~W~~L  121 (132)
T d1a25a_          80 KDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKL  121 (132)
T ss_dssp             GGCEEEEEEEECCSSSCCEEEEEEEEEHHHHTTCCEEEEEEC
T ss_pred             cCCEEeEEEEecCCCCCCcEeEEEEEeHHHcCCCCCCeEEEC
Confidence            5557999999999988 9999999999999977666778764



>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure