Diaphorina citri psyllid: psy13667


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MADAKKKTTKLTDEEVYNGFQNLRAEQRQIATKLSELEQELTEHKIVLDTLKDLDGDRRCFRLIGGVLCEKTVKEVIPTLTTNRDQLNTLINSLNEQLTKKGIEINEYKDKFDIQLQGNKTSAPPPKQENESAPRSAGVVVNPV
ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEccccccccccccccccccccccEEEccc
*******************FQNLRAE************QELTEHKIVLDTLKDLDGDRRCFRLIGGVLCEKTVKEVIPTLTTNRDQLNTLINSLNEQLTKKGIEINEYKDKFDI******************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADAKKKTTKLTDEEVYNGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDGDRRCFRLIGGVLCEKTVKEVIPTLTTNRDQLNTLxxxxxxxxxxxxxxxxxxxxxFDIQLQGNKTSAPPPKQENESAPRSAGVVVNPV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Prefoldin subunit 2 Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.confidentO70591
Prefoldin subunit 2 Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.confidentB0BN18
Probable prefoldin subunit 2 Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.confidentQ9VTE5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048477 [BP]oogenesisprobableGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0007292, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0007276, GO:0000003
GO:0051086 [BP]chaperone mediated protein folding independent of cofactorprobableGO:0071704, GO:0044267, GO:0009987, GO:0006457, GO:0044260, GO:0044238, GO:0051084, GO:0006458, GO:0044237, GO:0043170, GO:0019538, GO:0008150, GO:0008152, GO:0061077
GO:0030017 [CC]sarcomereprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0055120 [CC]striated muscle dense bodyprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0016272 [CC]prefoldin complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424
GO:0051082 [MF]unfolded protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0015631 [MF]tubulin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZDI, chain C
Confidence level:confident
Coverage over the Query: 8-119
View the alignment between query and template
View the model in PyMOL